(data stored in ACNUC7421 zone)

EMBL: BA000030.PE242

BA000030.PE242       Location/Qualifiers
FT   CDS_pept        complement(280342..280782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_242"
FT                   /old_locus_tag="SAV_242"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_242"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67951"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RA1"
FT                   /protein_id="BAC67951.1"
FT                   /translation="MGVRTAYKFNRSAARAVAAASLAWRTVRAPAGVNRRAPTPPISVI
FT                   SGPKTTDVDGSVARLAIVPAPNTPDLPSEHSPDGAGTGRVRFPLVQWVLAPRTTWQARR
FT                   LAADFGEGMDARTAWVMARLARHPDERDYAMAHLDDERRIAD"
     gtgggcgtga ggacggcata caagttcaac aggtccgctg cgcgtgcagt cgccgctgcg        60
     tcgctcgctt ggcgcaccgt gcgggcccca gcaggcgtca accgccgggc tccgacgccg       120
     cccatttcgg tgatctccgg cccgaagacc accgacgtcg acgggtccgt cgccagactc       180
     gcgatcgtgc ctgccccgaa cacccctgat ctcccctccg agcactcccc tgacggggca       240
     ggcaccggcc gggtccggtt cccgctcgtg cagtgggtgc tcgccccgcg cacgacgtgg       300
     caggcgcggc gcctggccgc cgacttcggt gaggggatgg acgcccggac cgcgtgggtg       360
     atggcacgcc tggcccgtca tcccgacgaa cgcgactacg ccatggctca cctggacgac       420
     gaacgccgca ttgcggactg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page