(data stored in ACNUC7421 zone)

EMBL: BA000030.PE246

BA000030.PE246       Location/Qualifiers
FT   CDS_pept        complement(283694..284041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_246"
FT                   /old_locus_tag="SAV_246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_246"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67955"
FT                   /db_xref="GOA:Q82R97"
FT                   /db_xref="InterPro:IPR004637"
FT                   /db_xref="InterPro:IPR012773"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R97"
FT                   /protein_id="BAC67955.1"
FT                   /translation="MVGVENGPRGPVFFSFEPAGIVPDIVCLSKSISGYGMPMALTLLR
FT                   PEYDVWKPGEHNGAFRGYNPAFLTGARALEGAALRPCGRGPARCAMRRTGEACCWRRPG
FT                   PTTRWPRSCRR"
     gtggtcggtg tggagaacgg accacggggt ccggtgttct tctccttcga gccggccgga        60
     atcgtccccg acatcgtctg cctgtccaag tccatcagcg ggtacgggat gcccatggcc       120
     ctcacgctgc tgcgtcccga gtacgacgtg tggaagcccg gcgagcacaa cggcgccttc       180
     cgcgggtaca acccggcgtt cctcaccggg gcccgggcgc tggagggggc tgctcttcgg       240
     ccgtgcgggc gcgggcccgc gaggtgtgcg atgcggcgta ccggggaggc ctgctgctgg       300
     agacggccgg gtccaacgac gaggtggcca cggtcctgcc gccggtga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page