(data stored in ACNUC7421 zone)

EMBL: BA000030.PE247

BA000030.PE247       Location/Qualifiers
FT   CDS_pept        284429..286645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_247"
FT                   /old_locus_tag="SAV_247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_247"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67956"
FT                   /db_xref="GOA:Q82R96"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R96"
FT                   /protein_id="BAC67956.1"
FT                   /translation="MLAQSSGQSVAAVGMGLLTALGGFYLAWKAFQQDRDQVTAMSLGT
FT                   AVDQLAEAVKKQWDAEASVRRLNDPYPLPVAWRAADADLVQPWTLLADVARGWPGGPPG
FT                   DPAQWPTDAAGLAGADAQIGEVFAQRVPTRRLVVLGDPGSGKSMLLIRLLHDLIAQRPD
FT                   DGPVPVLFSLASWNPTHRPLQSWLADQLRHTYPGLRAPAPSAAPQAGQIDLAQALLDTR
FT                   RILPLVDGFDELPPALHAIALDALNQALPAKQPLVLASRAAAYREALARSEVLVRPLNG
FT                   AAGIHLLPLPADQAATYLRHDAGGEHTPAADRWNSVAAHLGTNTLVGQALSTPLGLFLA
FT                   RTIYNPRPDILGAPAPVPHPDELYDTTIFPTRAALDTHLFNAYIPAAYTRHQPNPLRWS
FT                   PSQAYRTLVFLARHLETNRNGSPDLAWWELHHANPAYIRRLTAGLMVGLGPGLLLGLVY
FT                   GVGLGLAAGIGLAAGLTYGLIGGGLGSAPSNIPSTRLRWSRRRFAGWLGAGLALGLVGG
FT                   LAFGLGIAGERGAWLATGILPGEHGFVGWLAFGLALGLIAGLACGLTFGLTGEKPALTT
FT                   MIGPATLLIQDLRTFLGGGLAYGLGAGFVGGFIGWLVSWLAFGAEDGLAFGQAFGLAFG
FT                   LGASLEQTAWGDWVIAKAYLAMWRRAPWDLMTFLQDAHQHRGVLRQVGAVYQFRHLDLQ
FT                   RHLAQQPRSLPTYAGQPDSPSRLTGEQARSIHRRGNTRTGSLFD"
     gtgctggcgc agagctccgg ccagagcgtg gccgcagtgg ggatgggact actgacagcg        60
     ctgggaggct tctatctggc ctggaaggcc ttccagcagg accgcgacca agtcaccgcc       120
     atgagcctgg ggacggctgt cgaccagttg gcggaagcgg tgaagaaaca gtgggacgct       180
     gaggcgtcgg tccgccgttt gaacgaccca tacccactgc cggtcgcctg gcgggccgct       240
     gatgcagacc tggtacagcc ctggacgttg ctggccgacg tagcgcgggg ctggcccggt       300
     ggtccccccg gtgatcccgc ccaatggcct acggatgccg ccgggctggc gggcgctgat       360
     gcgcagatcg gtgaggtgtt tgcccagcgg gtacccaccc gccgcctggt cgtcctcggc       420
     gatcccggct ccggcaaatc catgctgctc atccgcctgc tccacgacct gatcgcacag       480
     cgacccgacg atggcccggt gccggtgctg ttctccctgg cctcctggaa ccctacccac       540
     cgacccttgc agagctggct ggccgaccag ctaagacaca cctaccccgg tctacgtgcc       600
     cccgcccctt cggccgcgcc ccaggcgggc cagatcgact tggcccaggc gctgctggat       660
     acccggcgga tcctgccgct cgtcgacggc ttcgacgagc tccctcctgc ccttcacgcg       720
     atagccctcg acgccctcaa ccaggccctg cccgcgaaac aacccctggt gctggccagc       780
     cgcgccgccg cctaccggga ggcactggcc cggtccgaag tcctggtgcg accgctcaac       840
     ggcgccgccg ggatccatct gctgcccctg cccgccgacc aggccgcaac ctacctgcgc       900
     catgacgcag gcggcgagca cacccccgcc gccgaccgct ggaacagcgt ggccgcccac       960
     ctgggcacga acaccctcgt cgggcaggcc ctgagcaccc ccctgggcct cttcttggcc      1020
     cgcaccatct acaacccacg ccccgatatc ctgggcgcac ccgcccccgt ccctcacccg      1080
     gacgagctgt acgacaccac catcttcccc acccgcgccg ccctcgatac ccacctgttc      1140
     aacgcctaca tccccgccgc ctacacccgc caccaaccga accccctccg gtggtctcca      1200
     tcccaggcct accgcaccct ggtcttcctc gcccgacacc tggagaccaa ccgtaacggc      1260
     agcccggacc ttgcctggtg ggaacttcac cacgccaacc ccgcgtacat ccgccgcctg      1320
     acagctgggc tcatggtcgg gctcgggcct gggctcctgc tcgggctcgt gtacggggtc      1380
     ggcctcgggc tcgcggccgg gatcgggctc gcggccggtc tcacgtacgg acttataggt      1440
     ggtgggcttg ggtccgcccc ctcaaacatt ccaagtacac ggctacgttg gtcgcgccgc      1500
     aggttcgcgg gctggctcgg ggccgggctt gccctcggac tcgtgggcgg actcgcgttc      1560
     gggctcggga tcgcgggcga acgcggagcc tggctcgcga ccgggatctt gcccggcgag      1620
     cacggattcg tgggctggct cgcgttcggg ctcgcgctcg gactcattgc cggactcgcg      1680
     tgcggactca cgttcggact cacaggcgag aagcctgccc taaccaccat gatcggccct      1740
     gcgacactac tcatccagga tctccgcacc ttcctcggag gcgggctcgc gtacgggctc      1800
     ggggccggat tcgtgggcgg attcataggt tggttggtga gctggcttgc attcggggct      1860
     gaggacggac tcgcgttcgg gcaggcgttc gggctcgcgt tcgggctcgg ggcctccctt      1920
     gaacagacag catggggcga ctgggtgata gccaaggctt atttggcaat gtggcgccga      1980
     gcgccttggg atttgatgac gttcctccag gatgcgcatc agcatcgtgg tgtcctgcgg      2040
     caggttgggg cggtgtacca gttccgccac ctggacctgc aacgccacct cgcccagcaa      2100
     ccccggtccc tccccaccta cgccgggcag cccgattcgc catctcggct cactggcgaa      2160
     caagcgcggt caattcatcg ccgcggaaac acccgaacag gaagcctgtt cgactga         2217
//

If you have problems or comments...

PBIL Back to PBIL home page