(data stored in ACNUC7421 zone)

EMBL: BA000030.PE248

BA000030.PE248       Location/Qualifiers
FT   CDS_pept        complement(287461..287775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_248"
FT                   /old_locus_tag="SAV_248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_248"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67957"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R95"
FT                   /protein_id="BAC67957.1"
FT                   /translation="MATENCRRDLTAICKAADSGYLLQVVRDDGFEPLAEKHLSHWPDW
FT                   PTFPVDAAHAAGCELIMLGYVIWPDTVTPDSLIGWRAVPDQQAWSAKVGTFAQVQAAGI
FT                   "
     atggcaactg agaactgccg ccgtgatctc actgccatct gcaaggccgc ggacagcggc        60
     tatcttctgc aagtggtccg ggatgacggc ttcgagcccc tcgccgagaa gcacctctca       120
     cactggcccg actggccgac attcccggtc gacgccgcgc atgcggcggg gtgcgaactc       180
     atcatgctcg gctacgtgat ctggcctgac actgtcaccc ctgactcgct gatcggctgg       240
     cgtgctgtac cggatcagca ggcatggtcg gcgaaggtcg gcaccttcgc ccaagtgcag       300
     gccgccggaa tctga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page