(data stored in ACNUC7421 zone)

EMBL: BA000030.PE249

BA000030.PE249       Location/Qualifiers
FT   CDS_pept        complement(288173..288562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_249"
FT                   /old_locus_tag="SAV_249"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_249"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67958"
FT                   /db_xref="GOA:Q82R94"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R94"
FT                   /protein_id="BAC67958.1"
FT                   /translation="MPGPKVTAAVGAVLSAATAVVTNLVTTRWSPALIAAAVVLVIAGA
FT                   AAAAASAAHGRSDSPPTARLTARRRGHLDRIRVAHGADAAVRIEATGSAAEVSNLEVNI
FT                   DNAEAIAKATGRGTISNSSIVQRNS"
     atgccaggtc cgaaggtcac ggcggcggtc ggagcggtgc tgtccgccgc caccgcggtg        60
     gtgaccaacc tggtcaccac ccggtggagc ccggccctga tcgctgcggc cgtggtcctc       120
     gtcatcgccg gtgccgcagc agccgcggct tccgccgcac acggtcggtc ggattcaccg       180
     ccgactgccc ggctcacagc ccggcgtcgc ggccacctcg accgcatccg ggtcgcccac       240
     ggcgccgacg ccgcagtgcg catcgaagcc accggcagtg cagccgaagt gtcgaacctg       300
     gaagtcaaca tcgacaacgc cgaggccatc gccaaagcaa ccggcagagg cacgatcagc       360
     aactcctcaa tcgtgcagag gaattcctga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page