(data stored in ACNUC7421 zone)

EMBL: BA000030.PE25

BA000030.PE25        Location/Qualifiers
FT   CDS_pept        complement(32197..32559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_25"
FT                   /old_locus_tag="SAV_25"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_25"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67734"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RW7"
FT                   /protein_id="BAC67734.1"
FT                   /translation="MREFPLDKHERTEADDRLDQILATTHAELVDAIATQQDHARTMTL
FT                   IPGSGTAEEPTKTIDRALWSYKEIAAYINVRPDKVRWYRKHGLLPAPDHVEGGKPYWYS
FT                   DTVRAWMASRPSRREP"
     atgcgtgagt tcccgctcga caagcacgag cggaccgagg ccgacgaccg cctggaccag        60
     atcctcgcca ccacccatgc cgagctcgtc gacgccatcg caacacaaca ggaccacgcg       120
     cgcacgatga cgctcatccc tggctccggt actgcggagg agccgacgaa gacgatcgac       180
     cgggcgctgt ggtcgtacaa ggagatcgcc gcgtacatca acgtgcggcc cgataaggtg       240
     cgctggtatc gcaagcacgg gcttttgccg gcgccggacc acgtggaagg cggcaagccg       300
     tactggtact ccgacactgt ccgagcctgg atggcgtcca ggcccagccg ccgcgaaccg       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page