(data stored in ACNUC7421 zone)

EMBL: BA000030.PE251

BA000030.PE251       Location/Qualifiers
FT   CDS_pept        complement(292968..293723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_251"
FT                   /old_locus_tag="SAV_251"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_251"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67960"
FT                   /db_xref="GOA:Q82R92"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R92"
FT                   /protein_id="BAC67960.1"
FT                   /translation="MTPKSDAAQSLVGDVRALTPPPGTHPLVGGIDAELVDAKHSISGQ
FT                   IPLAIGLVVVTTFVLLFLFTGSVVQPLRALALNAITLVATLGIMTRIFQDGHLSSLLGF
FT                   TAQPMEMSMTVLMFCIVFGLSMDYEVFVTSRIKELHAPGEDTESAVTNGLGHTGRIVTA
FT                   AACLLAVSFFAFGTAKLSFMQMFGLGSGLAILIDAVAIRGVLVPAAMRLLGDSAWYAPG
FT                   FLRRFHGRFGLSESAPESAAEPEPAVSRG"
     ttgacgccga agtccgacgc ggcgcagagc ctggtcggcg acgtacgggc gctcaccccg        60
     ccccccggca cccacccgct ggtgggcggc atcgacgccg aactggtcga cgccaagcac       120
     tccatcagcg gccagatccc gctcgccatc ggcctggtgg ttgtgaccac cttcgtcctg       180
     ctcttcctct tcaccggcag cgtggtgcag ccgctgcgcg ccctggccct gaacgcgatc       240
     accctggtgg cgacgctcgg catcatgacc cggatcttcc aggacggcca tctctcctcc       300
     ctgctcggct tcacggcgca gccgatggag atgtcgatga ccgtgctgat gttctgcatc       360
     gtcttcggtc tctcgatgga ctacgaggtg ttcgtcacca gccggatcaa ggaactccac       420
     gccccgggcg aggacaccga gtccgccgtc accaacggcc tcgggcacac cgggcgcatc       480
     gtcaccgccg ccgcctgcct gctcgcggtg agcttcttcg ccttcggtac ggccaagctc       540
     agtttcatgc agatgttcgg tctcggcagc ggactggcga tcctgatcga cgctgtcgcc       600
     atccgtggtg tgctcgttcc cgccgcgatg cgcctgctcg gcgactcggc ctggtacgcg       660
     cccggcttcc tgcgcagatt ccacggccgg ttcggcctca gcgaaagcgc gcccgagtcc       720
     gctgccgagc ccgaacccgc agtctcacgg ggttga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page