(data stored in ACNUC7421 zone)

EMBL: BA000030.PE253

BA000030.PE253       Location/Qualifiers
FT   CDS_pept        294912..295244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_253"
FT                   /old_locus_tag="SAV_253"
FT                   /product="putative MutT-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_253"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67962"
FT                   /db_xref="GOA:Q82R90"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R90"
FT                   /protein_id="BAC67962.1"
FT                   /translation="MPSGKLDQGDPLPAGAARELFEETGITVAPGHLRLVHVVHHRQDD
FT                   EVERIGFFFEATDWQGEPVNREPDKCLALTWFTVHELPDGIIEYPQAGLRGYLDETGPL
FT                   VAHNWE"
     atgccttccg gcaagctcga ccagggcgat cccctgcccg ccggtgctgc ccgcgaactg        60
     ttcgaagaga ccggaatcac cgtcgccccg ggccacctcc ggctcgtcca cgtcgtgcac       120
     catcgccaag acgacgaggt ggaacggatc ggcttcttct tcgaagccac ggactggcag       180
     ggagaacccg tcaaccggga gccggacaag tgcctcgcct tgacctggtt caccgtgcac       240
     gaactgcccg acggcatcat cgagtacccg caggccggac tgcgcggata tctcgacgag       300
     accggtcccc tcgtcgcaca caactgggag tag                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page