(data stored in ACNUC7421 zone)

EMBL: BA000030.PE266

BA000030.PE266       Location/Qualifiers
FT   CDS_pept        complement(307092..309302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_264"
FT                   /old_locus_tag="SAV_264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_264"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67973"
FT                   /db_xref="GOA:Q82R80"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R80"
FT                   /protein_id="BAC67973.1"
FT                   /translation="MTPATPTPPSSTPPSWPQCGHGTTPEDPAGCRGIRVSGHTACLAH
FT                   LSDADRDAYLAGLSPGNNVDHRGTSFSQDLLDALLDALRDPDTGDPRLGVARFRSATFQ
FT                   RDVGFRSATFQKWADFGSATFQGNAGFRLATFEGDAGFGSARFEGDAGFGSARFEGDAS
FT                   FVSATFEGDASFVSATFEGDASFVSATFQSAASLGWAAFQGDVKFESATFQGDAVFGGA
FT                   DFRGDARFGLAAFERNARFGLARFRGIASFWLVTFHGDAWFRSAIFRGDASFVSATFQS
FT                   DTDLEAATFSDHTRFDRATFFGDARFVEATFRGDTSFVSATLQSNANFLGVTFERDAKF
FT                   ESSIFQGDATFVSATFECDACFEQVGFERSASLGPLVCAGRVKLSGAVFGCPVTLSFAT
FT                   RCLECRRTRWSSTAELRLRYATVDFAHAVFEYPLTIAAEADPFVLHNGRPVAEQSLIDA
FT                   PDIEVRIASLRGVDAAHLVLSDVDLSGCLFTGTVHLDQIRLEGTCSFASVPRRTHWRRW
FT                   RPLRFTQRRALAEEGFWRASQPTPVPGWNAAVAGAVHAGPAQLAPVYRALRKAFEDSRN
FT                   EPGAADFYYGEMEMRRHDRTGSTRTERGLLHGYWLLSGYGLRASRALGWLAAAMLVTIV
FT                   LLMGFGLPKDSPKQVATGTVPPGDGKVTLEIDKADPQNPTGDRFTSERFEKALTGTLNS
FT                   VVFRSSGQDLTTAGTYIEMASRVTEPVLLGLAVLAVRNRVKR"
     atgacgcccg ctacacccac accaccgtct agcaccccgc cgtcgtggcc gcagtgcggc        60
     cacggcacca caccggagga ccccgccggc tgccgcggga tccgcgtatc cggccacact       120
     gcatgcctcg cccacctttc cgatgccgac cgcgacgcct acctggccgg cctgagcccc       180
     ggcaacaacg tcgaccaccg cggtacttcc ttcagccaag acctgctcga tgccctcctc       240
     gatgccctcc gcgatcccga caccggcgac ccccgcctcg gtgtcgcccg gttcaggtcg       300
     gcgaccttcc agcgcgacgt aggattcagg tcggcgacct ttcagaaatg ggccgacttc       360
     gggtcggcga ccttccaagg caacgccggg ttcaggttgg caaccttcga gggcgacgcc       420
     gggtttgggt cggcccgctt cgagggcgac gccgggtttg ggtcggcccg cttcgagggc       480
     gacgccagct tcgtgtcggc tactttcgaa ggcgacgcca gcttcgtgtc ggctactttc       540
     gaaggcgacg ccagcttcgt gtcagcgacc ttccaaagcg ccgccagcct cgggtgggca       600
     gccttccaag gcgacgttaa gttcgagtcg gccaccttcc agggcgacgc cgttttcggg       660
     ggtgcggact tccgaggcga cgctcggttc gggttggcgg ccttcgagcg caacgctcgg       720
     ttcgggttgg cgagattccg gggcatcgcc agcttctggt tggtgacctt tcatggcgac       780
     gcctggttca ggtcggcgat tttccgtggc gacgccagct tcgtgtcagc gacattccaa       840
     agcgacactg acttggaggc ggcgaccttc tctgaccaca cccgattcga cagggctacc       900
     ttcttcggcg acgcccggtt cgtcgaggcg accttccgcg gtgacaccag cttcgtgtca       960
     gcgactctcc aaagcaacgc taacttcctg ggagtgacct tcgagcgcga cgctaagttc      1020
     gagtcatcga tcttccaggg ggacgccacc ttcgtgtcgg caaccttcga gtgcgacgcc      1080
     tgcttcgagc aggtgggttt cgagcggtcg gccagtctcg ggccgttggt gtgtgccggg      1140
     cgggtgaagt tgtccggggc ggtgttcgga tgcccggtga ccctgtcgtt cgccacgcgc      1200
     tgcctggagt gccgacggac gcgttggtcg tcaacggccg agctgcgcct gcgctatgcc      1260
     acggtggact tcgcccatgc ggtcttcgag taccccctga cgatcgccgc ggaggccgac      1320
     cccttcgtgc tccacaacgg acgaccagtg gcagaacaga gccttatcga cgcgcccgac      1380
     atcgaagttc gcatagcttc gctgcggggg gtagacgcgg cccatctggt cctctccgac      1440
     gtcgacctgt caggatgcct gttcaccggc accgtgcatc tggaccagat ccggctggag      1500
     ggcacctgct ctttcgccag cgtcccgcgc cgcacgcact ggcggcgctg gcgccccctt      1560
     cggttcaccc agcgacgcgc cctcgccgaa gaaggctttt ggcgtgcaag ccagccgaca      1620
     ccagtgccgg gctggaacgc ggcagtggcc ggcgccgtac acgccggacc ggcacagttg      1680
     gcgccggtgt accgggcgct gcgcaaggcg tttgaggaca gcaggaacga gccgggggcg      1740
     gcggacttct actacggtga gatggagatg cgccgccacg accgcaccgg cagcacccgc      1800
     accgaacgcg gcctgctgca cggctactgg ctgctgtccg gctacggcct gcgcgcctcc      1860
     cgggccttgg gctggctcgc cgcagccatg ctcgtcacca tcgtgctgct gatgggcttc      1920
     gggctcccga aggactctcc gaagcaggta gcgaccggca ccgtgccccc cggcgatggc      1980
     aaggtcactc tcgagatcga caaggctgat ccccaaaacc ccaccgggga caggttcacc      2040
     agcgagcgct tcgagaaggc actgaccggc acgctcaact cggtggtctt tcgctcctcc      2100
     ggacaggacc tgaccactgc tggcacctac atcgaaatgg cgtcccgcgt gaccgaaccc      2160
     gtcctcctgg gcctggcggt cctggccgtc cgtaaccgcg tcaaacgctg a               2211
//

If you have problems or comments...

PBIL Back to PBIL home page