(data stored in ACNUC7421 zone)

EMBL: BA000030.PE269

BA000030.PE269       Location/Qualifiers
FT   CDS_pept        311330..311680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_267"
FT                   /old_locus_tag="SAV_267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_267"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67976"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R77"
FT                   /protein_id="BAC67976.1"
FT                   /translation="MLEDPAAHGVDLDCTMVLHELTGDEWPATRAHAEEFVLPHLREHR
FT                   VRLVQVARASRSLEITVIDDSRQPQRIVERGPWALWDEYESGGTVPQQGGIRLCSLHAK
FT                   GNWRMPLSPTTC"
     atgctggagg acccggccgc tcacggagtc gacctggact gcaccatggt gctgcacgag        60
     ctcaccgggg acgagtggcc ggccacccgc gcccacgccg aggagttcgt gctgccgcac       120
     cttcgcgagc accgtgtccg gctcgttcaa gtcgcccggg ccagccgctc gttggagatc       180
     acggtcatag acgactcccg ccagccgcag cggatcgtcg agcgggggcc ctgggcactg       240
     tgggatgagt acgagtcggg cggcaccgtt ccccagcagg gcggtattcg gctctgcagc       300
     ctgcatgcca agggcaactg gcggatgccc ttgtcaccga ctacctgctg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page