(data stored in ACNUC7421 zone)

EMBL: BA000030.PE27

BA000030.PE27        Location/Qualifiers
FT   CDS_pept        complement(33121..33411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_27"
FT                   /old_locus_tag="SAV_27"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_27"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67736"
FT                   /db_xref="GOA:Q82RW5"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RW5"
FT                   /protein_id="BAC67736.1"
FT                   /translation="MMRGSGCAAETEMGGTMDPVTFTAGCGVATSAVRLGYVWLSAWSH
FT                   RRRVELEIHRAELERATLMETISSLPPGSEVTEVLRDGRRVTIKLPPSKAA"
     gtgatgcggg gctcgggatg cgccgccgag acagaaatgg gaggcaccat ggacccggtg        60
     acgttcaccg cgggctgtgg cgtggcgact tcggcggtcc ggctcggata cgtctggctg       120
     agcgcgtggt cgcacaggcg ccgcgtcgag ttggagatcc atcgcgctga gttggaacgt       180
     gcgactctga tggagaccat cagctcgctg ccgcccggca gcgaggtcac tgaggttctg       240
     cgcgacggcc ggcgggtcac gatcaagctc ccgcccagta aggcggcgtg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page