(data stored in ACNUC7421 zone)

EMBL: BA000030.PE270

BA000030.PE270       Location/Qualifiers
FT   CDS_pept        complement(312030..312479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_268"
FT                   /old_locus_tag="SAV_268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_268"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67977"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R76"
FT                   /protein_id="BAC67977.1"
FT                   /translation="MQSAGDVGYEHAQVGEEYWAGLPLPWNESGKDIQITRAKFTHVPK
FT                   GLKVIEYRAFNGDDTDGNVLFARTDGKGSVGDLFKARNYAGHPMTVKAKTGSHVYYVAR
FT                   VKVTGPIHDNLSGCSYWYRQGSTEFQQQLDCSTIVRLGKPLKYEG"
     atgcagtccg ccggtgacgt cggctacgaa cacgcccagg tcggcgagga gtactgggcc        60
     ggactgccgc tcccctggaa cgagtccggc aaagacatcc agatcacgcg ggcgaagttc       120
     acccacgtcc ccaagggtct gaaggtcatc gagtaccggg ccttcaacgg cgacgacacc       180
     gacggcaatg tcctgttcgc acgcaccgac ggcaagggca gcgtgggcga cctgttcaag       240
     gctcgcaact acgccggcca tcccatgacg gtgaaagcga aaacgggcag ccacgtgtac       300
     tacgtggcac gggtcaaggt caccggcccg atccacgaca atctgtccgg ctgcagctac       360
     tggtaccggc agggttccac ggagttccag cagcaactgg actgctcgac catcgtccgc       420
     ctcgggaaac ccctcaagta cgagggctag                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page