(data stored in ACNUC7421 zone)

EMBL: BA000030.PE273

BA000030.PE273       Location/Qualifiers
FT   CDS_pept        complement(317520..317873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_271"
FT                   /old_locus_tag="SAV_271"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_271"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67980"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R73"
FT                   /protein_id="BAC67980.1"
FT                   /translation="MGVERGAMLDELVSAAAAAGGSAVVQAAGTDLWNGFRGRVAEWFG
FT                   RGDAVRESRELERLDRSASELSTAGQDEVERLRVRHEAVWQSRIETLLEDLDGVERDQA
FT                   VAELSKLMAQARP"
     atgggagttg aaagaggcgc catgctggac gagttggtat cggcggcagc ggcggcgggc        60
     ggatctgcag tggtccaggc agcggggact gacctgtgga acggttttcg gggccgggtc       120
     gccgagtggt tcggacgtgg ggacgcggtg cgggagagcc gtgagctgga gcggctggac       180
     cgcagcgcgt ccgaactgtc gacggccggc caggacgagg tggagcggct ccgggtgcgg       240
     cacgaggccg tctggcagag ccggatcgag accctgctgg aggacctgga cggggtcgag       300
     cgcgaccagg cggtggcgga gctcagcaaa ctcatggccc aggcccgccc atag             354
//

If you have problems or comments...

PBIL Back to PBIL home page