(data stored in ACNUC7421 zone)

EMBL: BA000030.PE279

BA000030.PE279       Location/Qualifiers
FT   CDS_pept        323014..323400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_277"
FT                   /old_locus_tag="SAV_277"
FT                   /product="putative terminal protein Tpg homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_277"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67986"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R67"
FT                   /protein_id="BAC67986.1"
FT                   /translation="MHALLILHAAGYRWEVVDSLAALRLAVPGRSAAYTARSRVTPLGV
FT                   RESITARDQSSFFAARSFLSSTTCSSSHHAARLLQAQQDGTDEDDLRQIAAEALGEVYF
FT                   RDNGRRAQSLEVKLTDLVDLKFEL"
     gtgcacgcac tgctgatact ccacgctgcg ggctaccggt gggaggtggt cgactcgctt        60
     gcagcgcttc ggctggcagt tcccggccga agcgctgcat acaccgctcg ctcacgcgtc       120
     acgcctctcg gtgtgcgaga gtcgatcacc gcccgcgacc agtccagctt cttcgcggcc       180
     cgcagctttc tcagcagcac tacgtgcagt tcgtcccacc acgccgcccg cctcctccag       240
     gcccagcagg acggcaccga cgaggacgac ctccgccaga tcgccgccga agcgctcggc       300
     gaggtctact tccgcgacaa cggccgccgc gcccagagcc tcgaagtgaa actcaccgac       360
     ctcgtcgacc tcaagttcga gctgtag                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page