(data stored in ACNUC7421 zone)

EMBL: BA000030.PE282

BA000030.PE282       Location/Qualifiers
FT   CDS_pept        325362..325622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_280"
FT                   /old_locus_tag="SAV_280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_280"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67989"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R64"
FT                   /protein_id="BAC67989.1"
FT                   /translation="MAAGPLCERGVFSLTFFTSMVWGSTASPGAPSRYRPLGRLSRSCG
FT                   RRKKTRRVYRPLSGSGCLAGPATRGRAGRARRTGAVAGREQ"
     atggcggcgg gcccgctctg cgagcgtggg gtcttctcgc tcactttctt cacctcgatg        60
     gtgtgggggt ccacggcttc gccgggggcg ccttcgcggt acaggccgct ggggaggctg       120
     tcgcggtcgt gcgggaggag gaagaagacg cggcgcgtgt acaggccgct gtcggggtcg       180
     ggttgcttgg ctggccctgc gacgcgaggg agggctggac gcgctcgtcg aactggtgca       240
     gtggcgggcc gagaacagtg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page