(data stored in ACNUC7421 zone)

EMBL: BA000030.PE283

BA000030.PE283       Location/Qualifiers
FT   CDS_pept        325633..326067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_281"
FT                   /old_locus_tag="SAV_281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_281"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67990"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R63"
FT                   /protein_id="BAC67990.1"
FT                   /translation="MWPRDLEHLRELALEFRIMHLKSELNAALGRFSIGIGGLDDRYPT
FT                   ILSVAFLQLYNHLAEDATIRECANETCRRNFVRQRGRAEYGQNRTSGIKYCTRECARAQ
FT                   AQRELRRRRRQQNSPLQQPRSEKPAPQDSPEAVGQAGGER"
     gtgtggccgc gtgacctgga gcatctgcgt gagctcgccc tggagttcag gatcatgcac        60
     ttgaagagtg agctgaacgc cgcgctggga cggttcagca tcggcatcgg cggcctggac       120
     gaccgctacc ccaccatcct ctcggtggcg ttcctgcagc tctacaacca ccttgccgaa       180
     gacgccacga tccgcgagtg cgccaacgag acctgccgcc ggaatttcgt acgccagcgc       240
     ggccgcgccg agtatgggca gaaccgcacc agcggcatta agtactgcac tcgcgagtgc       300
     gcccgcgctc aggcgcagcg cgaactccgc cggcgccgca gacagcagaa ctcgccgctc       360
     cagcaaccac ggtccgagaa gccggcgccg caggacagtc cggaggcggt cggccaggcg       420
     ggaggcgagc ggtga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page