(data stored in ACNUC7421 zone)

EMBL: BA000030.PE284

BA000030.PE284       Location/Qualifiers
FT   CDS_pept        complement(326189..326509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_282"
FT                   /old_locus_tag="SAV_282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_282"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67991"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R62"
FT                   /protein_id="BAC67991.1"
FT                   /translation="MDTARLRSLIDGVLLTQYRRYTEKELPALCERLGLPSPSAGDTKH
FT                   KRLVASLKACPDDRLPDVAEAVLEQEELDQAERMALLASDTKIARLAAPRAPRVVRRPK
FT                   KK"
     atggacacgg cgcggttgcg gagtctgatc gacggcgtgc tcctcacgca gtacaggcgc        60
     tacaccgaga aggaactgcc ggcgctgtgc gagcgcctcg gccttccctc gcccagcgcg       120
     ggcgacacca agcacaagcg cctggtagcc agcctgaaag cctgccccga cgaccgcctg       180
     ccagatgtcg ccgaggcggt tcttgagcag gaggagttgg accaggccga acgaatggcg       240
     ctgctggcca gcgacaccaa gatcgctcga ctggctgctc cccgggcgcc gcgtgtcgta       300
     cggcgcccaa agaagaagta g                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page