(data stored in ACNUC7421 zone)

EMBL: BA000030.PE285

BA000030.PE285       Location/Qualifiers
FT   CDS_pept        326629..327654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_283"
FT                   /old_locus_tag="SAV_283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_283"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67992"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R61"
FT                   /protein_id="BAC67992.1"
FT                   /translation="MSHKSIHEHLLISARKWARTAVDAYLEEPIDQDFAVHHMAVAVEH
FT                   ASKAYLASIAPVLLASEKQPSVDDLLVLSGNEDKTKKGRAGLKTIGGEGAILRAAQLLG
FT                   PGHKGPAKLKELRESRNGITHMGWGQPVTECRELLAAGIEHINALLKALSTEPDGFWGT
FT                   HLEACTALVAQAMSEMEIRYHAKLRQARERFAETTRRLSEAEIAELASSLSALPTAHSS
FT                   RSKTEARTVESGSLTHWDHETRAPMSCSTLSARVSCMMCGPARAAMRRARPRRSSAARR
FT                   CEPPPHRARRPGQSDRARTGRRPGTSAERLPGPAHRRRLPRRKGSPRLRRERTQVRGRL
FT                   R"
     atgtcgcaca aatcgatcca cgagcacctg ctgatatcgg cccggaagtg ggcgcgcacg        60
     gcggtcgacg cgtacctgga ggagcccatc gaccaggact tcgccgtgca ccacatggcg       120
     gtcgcggtgg aacacgcgtc caaggcatac ctggcgtcca tcgctcccgt gctcctcgcg       180
     tcggagaagc aaccgagcgt cgacgacctg ctggtcctga gcgggaacga ggacaagacg       240
     aagaagggcc gcgccgggct caagaccatc ggcggcgagg gcgccatcct cagggcagcc       300
     cagctcctcg gccccgggca caaggggcct gccaagctca aggaactgag ggagtcgcgc       360
     aacggcatca cccacatggg gtggggccag cccgtaaccg agtgccgcga actcctggcc       420
     gcgggcatcg agcacatcaa cgcgctcctg aaagctctgt cgacagagcc cgacggcttc       480
     tggggcacac acctcgaagc ctgcaccgcg ctggtggccc aggccatgag cgaaatggag       540
     atccggtatc acgcgaaact ccggcaggcc cgcgagcggt tcgccgagac cacccggcgc       600
     ctgtccgaag ccgagatcgc cgagcttgcc agcagtctct ccgctctgcc gacagcgcac       660
     tcttcgagga gcaaaactga ggcgcggaca gtcgagtccg gctccctcac gcactgggac       720
     catgagacac gcgccccgat gagctgcagc actctctcgg cccgggtgag ctgcatgatg       780
     tgcgggccgg cccgggccgc gatgcgtcga gcgcgtcctc gccgatcctc cgccgcccgt       840
     cggtgtgaac cgccgccgca ccgcgctcgg cgccccggac aaagtgaccg tgcgcgaact       900
     ggcaggcgtc ccggcacaag cgctgagcga ttaccgggac cggcacaccg gcgacgactc       960
     cctcgtagaa aaggctctcc tcgcctgcgc cgcgagcgga cacaggtccg aggccgactt      1020
     cgatag                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page