(data stored in ACNUC7421 zone)

EMBL: BA000030.PE286

BA000030.PE286       Location/Qualifiers
FT   CDS_pept        complement(327842..327994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_284"
FT                   /old_locus_tag="SAV_284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_284"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67993"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R60"
FT                   /protein_id="BAC67993.1"
FT                   /translation="MAAASRRSPRRSQAVGPELVAGQVANRFHAAWSVPRASRTAATTD
FT                   GCALP"
     gtggcagccg cgtccaggag gtcaccgagg cgcagccagg cggtcggtcc ggagttggtt        60
     gccgggcagg tcgcgaaccg gttccacgcg gcctggtcgg tgcccagggc atcgcgtacc       120
     gcggcgacca ccgacggatg cgcgctcccg tag                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page