(data stored in ACNUC7421 zone)

EMBL: BA000030.PE287

BA000030.PE287       Location/Qualifiers
FT   CDS_pept        328293..328691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_285"
FT                   /old_locus_tag="SAV_285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_285"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67994"
FT                   /db_xref="GOA:Q82R59"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R59"
FT                   /protein_id="BAC67994.1"
FT                   /translation="MQGTARRRAGERSADDVDAEGAGQGGQLVVVSLADRAYAPTFGRA
FT                   GLRRIRFHNLRHSTATLLLEQGVDLVVIKELLGHAHIGVTATVYAHLRLRLQRDAIDLL
FT                   GNALRNPDETAIRPDDGDGPPLCAAPVH"
     gtgcagggca ctgcccggcg gagggcgggt gagaggtcag ccgacgatgt cgacgccgaa        60
     ggcgcgggcc aaggcggcca gttggtggtc gtatccctgg ccgaccgcgc gtacgcgcca       120
     accttcggcc gagccggact ccgacgcatc cgcttccaca acctccgcca ctcgaccgcg       180
     accctgctcc tggaacaggg cgtcgacctc gtcgtgatca aggaactcct cggacacgcc       240
     cacatcggcg tcaccgccac ggtgtacgcc cacctccgac tccgcctcca gcgcgacgcc       300
     atcgacctcc tcggcaacgc ccttcgcaac cccgacgaga ccgccatccg acccgacgac       360
     ggtgacggac ccccactttg tgcagcaccc gtccactga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page