(data stored in ACNUC7421 zone)

EMBL: BA000030.PE288

BA000030.PE288       Location/Qualifiers
FT   CDS_pept        complement(329452..336546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_286"
FT                   /old_locus_tag="SAV_286"
FT                   /product="putative large secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_286"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67995"
FT                   /db_xref="GOA:Q82R58"
FT                   /db_xref="InterPro:IPR003284"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="InterPro:IPR032871"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R58"
FT                   /protein_id="BAC67995.1"
FT                   /translation="MAVRRARLVSVGFAGAVLAGLLSTVSVVSPIQAAAASDDPTPVVP
FT                   SQSLGSVPAQQTEEVGKALPAPKWPSAAEATVDLSEAAAGEPGTVSPEPSASASGGVGD
FT                   GESTQVGEVVEVAPVAEDLGTEAQLSLSRLADESTPSPSPSVSDGSEPSTPPTAEASPS
FT                   PEPSESASDEPIQDPVSPDQVEVRVLDREAVAPAGGIGLGLQVSRTDGVDAPGQVQVDI
FT                   DYSGFKYAYGADFASRLRLVKVPACALQTPDAESCADREFVPVDNDTDSGTLTATVTAA
FT                   ADTGSAGASAQLMREAGSSSASVYAVTSSSSSDAGDYRASTLSPTGSWEVSTGSGSFNY
FT                   SVPIQVPAPPMGSAPSLAMSYDSQSVDGRTSASNNQASWSGMGWDLNVGFIERRYRNCT
FT                   EDGLPTIGDMCWDSPNSAKEPDGAAYVISLNGTTSELIQDNNGSGAYHLKNDPGWRVQR
FT                   LFDGHGAGRNGEYWVISTQDGQRYYFGWGRSERTSTATASVFTVPVVGNDAGEPCHDQF
FT                   PEPCTQAWRWNLDRAVDANEVETMYFYDKEYNHYRSVANTDKAREYVSSGYVKEIQYGW
FT                   SSQITDGKVPAKVELSHVNRCIERVQENDPLRDEPAACPAFDDKPGSYPDVPVDLMCDG
FT                   TSADYNCAGKTYFPTFFSTDMLWDIKTYVSDQDGTGWDLVQQYQNKYGMPNPDGTIGKT
FT                   LWLDYIQRKTYGDGDDIVLPVINFNRTDLDNKVGSAELNFPRIKEIHGDLGATTTVSYG
FT                   FANACDIDHLPAQASNTQDCYWQKWTPEGETDSKTGWFKKFLVTQVQVDPTVTTNQDGA
FT                   PVMTTSYTYEDGAGWHFTNDPLIKDEDESWTDWRGYQEVQVTTGAGAGQKTKKSWLYRG
FT                   LSGDRTSKADASATKTVTVDDGDGNNYTDDSWLSGRILSTSLRDDTGTSHERTYHKYWD
FT                   HNTAQYDGLPDARFVREKETTTNTKVSSGWREHTVETEYDDTEGASTTFGLPMRTDDWG
FT                   QSSVSDNRCTTYGRAYNTDNYDSTGAQRWTVLQDQVKHYSVGCSSIADSKQDGYASTLY
FT                   DNATSVDANKPVDGNPTESRTYTKSGSYRSTWSGYDDAGRVMWSEDGSHNRTLTKYSPA
FT                   NTWPLNGVIVTTPDPDGALPAHTALTSTAWTSRFWGKPTSIQDANGNVTKMSLDAAGRL
FT                   VEVWRPTETGSSPSMKFSYTIPTSTNSAGVPDAVDGYPHVATHVLQSGTTYLSSHAYVD
FT                   GLGRARETQTPMGNGVDAATGNEVPNRQVSVTRYDSAGNVTGTSAVFRNQGTAGSGGPS
FT                   SAKVEDLPSYTDLVLDWAGRAITSRLQVNGASQDAGRVDTTYDGDFTSVKNKVDAAADT
FT                   YTDVYGQVSKVVEHTGSATYTTAYTYTAKDELIKITDPRGNDTSYTYDWAGQRTATDDS
FT                   DAGVSSTEYDKNGQISKITSNGGKTVLDYGYDALGRKTAVRSGDTELAAWTWDGLNITG
FT                   GKGQITSTTSRDTNGNTYTTKTGEFDVRGRPLKTTVTIPDTVKGLAGSYTTGFTYDAAD
FT                   HVTSVAYPAAGGLPAETVNATYDGYGRPLRLQSALQTYIRSTGYDAYDRLTDRSYGVDS
FT                   VLPGIGAAAQRTYSYDDSNGTRELKSVATTTTLNKVVSERQKDTYTYDLAGKLTELREQ
FT                   ASGQTAQSQCFLYDDQARLTNAYTHTTTGICADKTKTASDFKGTAPYQTAYTYDRLGNL
FT                   QSITNTDSAGTATLHDYLYPGYDDTGTWTTANANQPHGVRKIDHKTGSTTTKSDQLYYF
FT                   DDGTMKQRVEPGITTDYTWTPQGQLEAVKTTKSSGSELTRYAYDADGNILVRTTPQETV
FT                   ASIDGMELRTTNGTTVTATRVYASGTATVAMRTTEGTTATNGKVTYLMADTQASTQLAV
FT                   DASTGASTRRRYTPFGDERSGTLPTGTDNGFLGKTEDTSTGLSLLGARAYDPNLGRFLS
FT                   PDPLATPYAPQNLNAYSYATNNPISYSDPSGLCRRDICGDGYPVAGDGERAGYTGQHPG
FT                   EHACTSCNSGNGGYLLAGVVPSDWDKAQEFYDRVAEIIVSWPAGWTDWNYKPHEDPLAD
FT                   LRVGQVVYNACEDVGGCPDGIDPQRDMLNAAVAIELPGTNGRGSSKKAAGPCKCFLAGT
FT                   DILMADGSTKDIEEVELGDKVQATDPKTGETGPREVTRLITTTGDKHFNKLSIATEDGA
FT                   EELTATHEHPFWSPSESAWITAGSLEPGMTLLTDDGDTVIVTGNRAFTQHATTYNLTVN
FT                   DLHTYYALAGTTPVLVHNSSCSTNAQILGDNMTAAGTIRPAETAAHHIVASASPKAASA
FT                   RAKLASVGIDINDADNGVFLPRGSASPNLTGASVHSRIHTNNYYGYVNDMMSGVRTANE
FT                   ARDVLNHIRNQLNAGYWP"
     gtggctgttc ggcgtgcgcg ccttgtttcg gtcggtttcg cgggtgcggt actggcgggg        60
     ttgctgtcga cggtatcggt ggtgtctccg atacaggcag ccgcggcttc tgacgatccg       120
     acgccagtgg tgccgtcgca gtctctgggg tcggtcccgg cgcagcagac tgaggaggtc       180
     ggcaaggcgc tccccgctcc gaagtggccg agcgcggccg aggcaacggt cgatctgtcg       240
     gaggcggctg ccggagagcc ggggacggtg tcgcccgaac catccgcgtc ggcttcgggc       300
     ggtgtcggtg acggtgagag cacgcaggtc ggcgaggttg tggaagttgc tccggttgcg       360
     gaggatctgg gcaccgaagc ccagctgagt ttgtcccggc tggccgacga gagcactcct       420
     tccccaagcc cgagcgtttc ggacggctcc gaaccgagca cgccccctac ggctgaggca       480
     agtccctcgc cggagccttc agagtccgct tcggatgagc ccatccagga cccggtgtct       540
     ccggaccagg tcgaggtgcg ggttctggac cgcgaggccg tggccccggc cggcggtatc       600
     ggcctggggc tgcaggtctc ccggaccgat ggcgtcgatg ccccggggca ggtgcaggtt       660
     gacatcgact attcgggctt caagtacgcc tacggcgctg acttcgcctc ccggctgagg       720
     ttggtgaagg tgcccgcgtg tgcactgcag acgccggatg ccgagagctg cgcagaccgc       780
     gagtttgtgc cggtggacaa cgacacggac tccggcaccc tgaccgctac cgtgacggcg       840
     gctgccgaca cgggctccgc gggtgcttca gcgcagctga tgcgggaggc gggctccagc       900
     agcgccagtg tgtacgcggt gacctccagc tcgtcctcgg acgcggggga ttaccgggcg       960
     tcgacactgt cgccgacggg ttcgtgggag gtgtccacag ggtcgggctc gttcaactac      1020
     agcgtgccga tccaggtgcc ggcgccgccg atgggctcgg cgccgtcgct ggcgatgtcg      1080
     tacgactcgc agtcggtgga cggccgtacc tctgcttcca acaatcaggc gtcctggtcc      1140
     ggtatgggct gggatctgaa cgtcggcttc atcgagcgcc gttaccgcaa ctgcaccgag      1200
     gacggcctgc ccacgatcgg tgacatgtgc tgggactcgc caaactcggc taaggagccg      1260
     gacggagcgg cctacgtcat cagcctcaac ggcaccacct cggagctgat ccaggacaac      1320
     aacggcagcg gcgcctacca cctcaagaac gacccgggct ggcgtgtgca gcgtctgttc      1380
     gacgggcacg gcgcgggccg caacggcgag tactgggtga tctcgaccca ggacggtcag      1440
     cgctactact tcggctgggg ccgctcggag cgcaccagta cggcgaccgc gtccgtgttc      1500
     accgtccccg tcgtcggcaa cgacgcgggc gagccgtgcc acgaccagtt ccccgagccc      1560
     tgcacgcagg cctggcgctg gaacctggac cgggcggtcg acgccaacga ggtcgagact      1620
     atgtacttct acgacaagga gtacaaccac taccgctcgg tcgccaacac cgacaaggcc      1680
     cgcgagtacg tctcatccgg ctatgtgaag gagatccagt acggctggtc ctcgcagatc      1740
     accgacggca aggtcccggc gaaggtcgaa ctcagccacg ttaaccggtg catcgagcgg      1800
     gtccaggaga acgaccccct gcgcgacgag cccgccgcct gcccggcctt cgacgacaaa      1860
     ccaggctcat accccgacgt gccggtcgac ctgatgtgcg acggcacgtc ggcggactac      1920
     aactgcgcgg gcaagacgta cttccccacg ttcttctcca cggacatgct gtgggacatc      1980
     aagacgtacg tcagcgacca ggacggcacc ggctgggacc tggtgcagca ataccagaac      2040
     aagtacggga tgcccaaccc ggacggcacg atcggcaaga ccctctggct cgactacatc      2100
     cagcgcaaga cgtacggcga cggcgacgac atcgtcttgc cggtcatcaa cttcaaccgc      2160
     accgacctgg acaacaaggt cggctccgcc gagctgaact tcccccgcat caaggagatc      2220
     cacggcgacc tcggcgccac caccacggtc tcctacggtt tcgccaatgc ctgcgatatc      2280
     gaccacctgc ctgctcaggc ctccaacacc caggactgct actggcagaa gtggaccccg      2340
     gaaggcgaga cggactcgaa gaccggatgg ttcaagaagt tcctggtcac ccaggtccaa      2400
     gtcgacccga cagtgacgac gaaccaggac ggcgcgccgg tgatgacaac ctcgtacacc      2460
     tacgaggacg gcgccggctg gcatttcacc aacgatccac tgatcaagga cgaggacgag      2520
     tcctggaccg actggcgcgg ctaccaggaa gtccaggtca ccaccggcgc gggcgccggc      2580
     cagaagacca agaagtcctg gctgtaccga ggcctgtcgg gggaccgtac gtccaaggcg      2640
     gacgcgtcgg cgacgaagac ggtcacggtc gacgacggcg acggcaacaa ctacaccgac      2700
     gactcctggc tgtccggccg catcctgtcc acatcgctgc gggacgacac cggcacctct      2760
     cacgagcgca cctaccacaa gtactgggac cacaacaccg cccagtacga cggactgccc      2820
     gacgcccgct tcgtccgcga gaaggaaacc accaccaaca ccaaggtcag cagcggctgg      2880
     cgcgaacaca cggtggaaac cgagtacgac gacaccgagg gcgcctccac cacattcggc      2940
     ctgccgatgc gcaccgacga ctggggccag agcagcgtct ccgacaaccg ctgcaccacc      3000
     tacggtcgcg cctacaacac cgacaactac gactccaccg gcgcccagcg gtggaccgtg      3060
     ctccaggacc aggtcaagca ctactcggtc ggttgctcca gcatcgccga cagcaagcag      3120
     gacggctacg cgtcgacgct gtacgacaac gccaccagcg ttgacgccaa caagcccgtc      3180
     gacggcaacc cgaccgagtc ccgtacctat acaaagtcgg gcagctatcg ctccacgtgg      3240
     tccggctacg acgacgcggg gcgtgtgatg tggagcgagg acggaagcca caaccgcacc      3300
     ctcacgaagt acagcccggc caacacctgg ccgttgaacg gcgtcatcgt caccactccc      3360
     gaccccgatg gggctctgcc cgcccacacc gcgctcacgt ccacagcatg gacatcccgg      3420
     ttctggggca agccgacctc gattcaggac gccaacggca acgtcaccaa aatgagcctg      3480
     gacgcggcgg gccgtctggt ggaggtgtgg aggccaaccg aaaccggcag ctcaccgtcg      3540
     atgaagttca gctacaccat ccccacctcc actaacagcg ctggagtgcc cgacgcggtc      3600
     gacggctacc cgcacgtcgc cacgcacgtc ctgcagtccg gcacgacata cctgtcctca      3660
     cacgcctatg tggatggcct gggccgtgcc cgggagacgc agacccccat ggggaacggc      3720
     gtcgatgcgg ccacgggcaa cgaggtgccc aaccggcagg tctcggtcac ccgctacgac      3780
     tcggccggca acgtgaccgg cacctcggcg gtcttccgca accagggcac ggcgggctcc      3840
     ggtggacctt ccagcgccaa ggtcgaggac cttccgtcct acacggacct ggtactcgac      3900
     tgggcgggcc gtgccatcac ctcacggctc caggtcaatg gcgcctcgca ggatgcaggc      3960
     cgcgtggaca cgacctacga cggcgacttc accagcgtca agaacaaggt cgacgctgcc      4020
     gccgacacat acaccgatgt ctacggacag gtgtccaagg tcgtcgaaca caccggcagc      4080
     gccacctaca cgaccgcgta cacgtacacg gccaaagacg aactgatcaa gatcactgac      4140
     cctcgaggaa acgacacctc ctacacctac gactgggctg gtcagcgcac cgccacggac      4200
     gactctgatg ccggggtcag ctccaccgag tacgacaaga acggccagat cagcaagatc      4260
     accagcaatg gcggaaagac tgtcctggac tacggctacg atgccctcgg ccgtaagacg      4320
     gcggtccgta gcggcgacac cgaactcgcc gcctggacgt gggacggcct gaacatcact      4380
     ggcggcaaag gccagatcac ctcgaccacc agccgtgaca cgaacggcaa cacctacacc      4440
     accaagaccg gcgagttcga cgtccgcggc cgcccactga agacgaccgt caccatcccc      4500
     gacaccgtga agggtctcgc cggtagctac acgaccggtt tcacctacga cgcggccgac      4560
     cacgtcacct cggtggccta cccggcagcc ggtgggctcc ccgcggagac cgtcaacgcg      4620
     acgtacgacg gctatggtcg ccctctgcgc ctgcaatccg cgctgcagac atacatccgc      4680
     tccaccggct acgacgccta cgaccgcctg acggaccggt cctacggagt cgactccgtc      4740
     ctccccggca tcggagcagc ggcacagcgc acctacagct acgacgacag caacggaacc      4800
     cgcgaactga agagcgtggc aacgaccacg accctcaaca aggtagtcag cgagcggcag      4860
     aaggacacct acacctacga cctcgccggc aaactgaccg agctgcgcga gcaggccagt      4920
     ggccagaccg cccagtcgca gtgcttcctt tacgacgacc aggcccgcct gaccaacgcc      4980
     tacacccaca ccaccacggg catctgcgcc gacaagacca agaccgcctc cgacttcaag      5040
     ggcaccgccc cctaccagac cgcatacacc tacgaccgtc tcggcaacct ccagtcgatc      5100
     accaacactg actcggccgg caccgccacc ctgcacgact acctctaccc cggctacgac      5160
     gacaccggca cctggacgac cgccaacgcc aaccaacccc acggtgtccg caagatcgac      5220
     cacaagaccg gcagcaccac caccaagtcg gaccagctct actacttcga cgacggcaca      5280
     atgaagcagc gcgtcgagcc gggcatcacc accgactaca cctggacccc gcagggacag      5340
     ctggaagcag tcaagaccac caagtccagc ggcagcgaac tcacccgcta cgcctacgac      5400
     gccgacggca acatcctcgt ccgcaccacc ccgcaggaaa ccgtcgcctc catcgacggc      5460
     atggaactgc gcaccaccaa cggcaccacc gtcaccgcga cccgtgtcta cgcgagcggt      5520
     acagcaacgg tcgccatgcg caccactgag ggcaccacgg ccaccaacgg caaggtcacc      5580
     tacctgatgg ccgacaccca ggcgtctacc caactcgccg tcgacgcatc gaccggagcc      5640
     tcgacccgcc gccgctacac ccccttcggc gacgaacgca gcggcaccct gcccaccggc      5700
     accgacaacg gattcctggg caagaccgag gacaccagca ccggcctctc cctcctcggc      5760
     gcccgcgcct acgaccccaa cctgggccga ttcctcagcc cggaccccct ggccacgccg      5820
     tatgccccgc agaacctcaa cgcctactcg tacgcgacca acaaccccat ctcctacagc      5880
     gatccatccg gtctgtgccg ccgcgacatc tgcggtgacg gttaccctgt cgccggcgac      5940
     ggggagcgtg ccggttacac gggccagcac ccgggagagc acgcctgcac ttcgtgcaac      6000
     agcgggaatg gcggttatct gctggctggc gtcgttccat cggactggga taaggcgcaa      6060
     gagttctacg accgagtcgc ggaaatcatc gtcagctggc cggctggttg gaccgactgg      6120
     aactacaagc cacacgagga ccccctcgcc gaccttcgcg tcgggcaggt tgtgtacaac      6180
     gcgtgtgagg acgtcggggg ttgtcctgat ggcatcgacc cgcaacgaga catgctcaat      6240
     gctgccgtag ccattgagct gcccggaacc aacggacggg gcagctccaa gaaggcggca      6300
     ggcccttgca agtgcttcct ggctggtact gacatcctca tggcggacgg atcgaccaag      6360
     gacatcgagg aggtggaact cggagacaag gtccaggcca ccgaccccaa aaccggcgaa      6420
     accggacctc gcgaggttac ccgtctcatc accactacgg gcgacaagca cttcaacaaa      6480
     ctctccatcg ccacggaaga cggcgccgag gaattgacgg cgacccatga acaccccttc      6540
     tggtcgccat ccgagagtgc ctggattaca gctgggagcc ttgaaccggg catgaccttg      6600
     ctcaccgatg acggtgacac cgtcatcgtc acgggcaacc gggcatttac ccagcacgcc      6660
     accacgtaca acctcacagt caatgatctg cacacgtact atgcactcgc cggtaccacg      6720
     ccagtcctgg tccataattc cagttgctcg accaatgccc agattttggg tgacaacatg      6780
     acggccgcag gtaccattcg gccggccgag acggcggcgc atcacattgt ggcaagtgca      6840
     tctcccaagg ctgcgtctgc acgggcgaaa ttggctagcg tcggaattga tataaatgat      6900
     gcggacaatg gagtattctt gccgcgcgga tcggcatcgc caaatctgac tggtgcgtct      6960
     gtgcactcaa ggattcacac aaataactac tatggctatg taaacgacat gatgtcggga      7020
     gtgaggactg ccaatgaggc cagagatgtt ctaaatcata ttagaaatca gctgaacgca      7080
     ggctactggc cgtag                                                       7095
//

If you have problems or comments...

PBIL Back to PBIL home page