(data stored in ACNUC7421 zone)

EMBL: BA000030.PE296

BA000030.PE296       Location/Qualifiers
FT   CDS_pept        complement(345361..345771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_294"
FT                   /old_locus_tag="SAV_294"
FT                   /product="putative invasion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_294"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68003"
FT                   /db_xref="GOA:Q82R50"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R50"
FT                   /protein_id="BAC68003.1"
FT                   /translation="MPDPSHNSLVTPPRRRHPGSTLMILTITLACLIALIFGASGVLNT
FT                   LALPKARELAAETGFSVAAYRRIGVLQLAGVAGVVLGLAVPPLGGLAGAGLLLLLAGAV
FT                   VVHLRQGDPVAKLVPAAVCAVLVASYLAALFA"
     gtgcccgacc catcccataa cagcctcgta acgccgccac gacgccgaca ccctggaagt        60
     accctcatga tcctgaccat caccctcgcc tgcctcatcg ccctgatctt cggggcaagc       120
     ggagtgctca acacactcgc attgccgaag gcacgtgagc tggccgccga gaccggcttc       180
     tccgtcgccg cttaccgccg catcggcgtg ctgcaactgg caggagtcgc cggcgtggtg       240
     ctcggcctcg ccgtgccgcc gctcggcggc ctcgcggggg ccgggcttct cctgctgctt       300
     gccggagctg tggtcgtgca cctgcgccag ggcgacccgg ttgccaaact cgtgcccgcc       360
     gccgtgtgcg cggtgcttgt cgcgtcatac ctcgcggcct tgttcgcctg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page