(data stored in ACNUC7421 zone)

EMBL: BA000030.PE30

BA000030.PE30        Location/Qualifiers
FT   CDS_pept        37653..38609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_30"
FT                   /old_locus_tag="SAV_30"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_30"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67739"
FT                   /db_xref="GOA:Q82RW2"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RW2"
FT                   /protein_id="BAC67739.1"
FT                   /translation="MNRLLLAAYPKSYRSRQGKELLACLAEAYPGRSWPPPREVAALVR
FT                   AGVQARARATVDDTTRPWWLDGIHLAALALAALALVPYLQDVWHWALHIDPGQHAIAFH
FT                   FSGWYPWAGGPTRIRLLPYGLLPLGGLIALLRGRAWIALPAAASMIWAGATTHGRTLFG
FT                   DEGKAGLSYYGLGAPITARDLALSGTLCAACAVLALCRPSRLRRRSYRWLAPVVLAMFV
FT                   AGGLHIISVSPTFQRGLFVLEVAALLGAWVATAATGDHRWLIPVAAVAIVRTQAIVAQP
FT                   DAFMQSFPDLVVLLLLIAPLPALAITAQRRQGQALPE"
     atgaatcgtc tgctgcttgc ggcctatccc aaatcctacc gttcccggca gggcaaggag        60
     ttgctggcct gccttgccga ggcgtatccc ggccgctcct ggccgccgcc gcgggaagtt       120
     gccgccttgg tgcgcgccgg ggtgcaggcc cgcgcccgtg ccaccgttga cgacactact       180
     cggccgtggt ggctggacgg catccatctg gccgccctgg ccctcgccgc gctggcgctg       240
     gttccgtact tgcaggatgt gtggcactgg gcactgcaca tcgaccccgg acagcacgcc       300
     atcgccttcc acttctccgg ctggtatccg tgggccggag gtcccacgcg gattcggctg       360
     ctgccctacg ggctgctccc gctgggcggc ctgatcgctc tgctgcgtgg cagagcgtgg       420
     atcgcgctgc cggccgcggc atccatgatc tgggccggcg ccacgaccca cggccgcacc       480
     ctcttcggcg acgagggcaa ggcgggcttg agctactacg ggttgggcgc cccgataacg       540
     gcccgtgacc tggcgctctc ggggacactg tgcgccgcgt gcgccgtgct ggcgctctgc       600
     cgacccagcc gtctgcgacg ccgctcgtac cgttggctag cccccgtcgt gctcgccatg       660
     ttcgtggccg ggggcctgca catcatctct gtcagtccga ctttccagcg cggcttgttc       720
     gtcctcgagg tcgccgcgct gctcggcgcg tgggtggcga cggcagccac cggcgaccac       780
     cggtggctga tccccgtcgc agcggtcgcg atcgtccgca cgcaggcgat cgtcgcccag       840
     ccggacgcgt tcatgcagtc ctttccggac ctggtcgttc tcctcctgct gatcgcaccc       900
     ctccctgccc tggcgatcac cgcccagcgc cgacagggcc aggcactccc cgaatag          957
//

If you have problems or comments...

PBIL Back to PBIL home page