(data stored in ACNUC7421 zone)

EMBL: BA000030.PE304

BA000030.PE304       Location/Qualifiers
FT   CDS_pept        354545..354832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_302"
FT                   /old_locus_tag="SAV_302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_302"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68011"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R42"
FT                   /protein_id="BAC68011.1"
FT                   /translation="MAGRWQCRSRSQSSPRWQRIIRPVGRARRLSGYSPGMVWSWLSAR
FT                   RTWRSIRQNTSRATQITWMSAATRPLCWTKTGVTARGPLKSLLNRRLVWG"
     ttggcgggtc ggtggcagtg ccggtcccgc agccagagtt caccgaggtg gcagaggatc        60
     atccggccgg tcggccgtgc acgccggttg tcgggataca gcccgggcat ggtctggtca       120
     tggctcagcg cgcgccggac ctggcgctcg atcaggcaga acaccagcag ggccacgcag       180
     atcacctgga tgagtgcggc gacgcggccg ttgtgctgga cgaagaccgg ggtgacggcg       240
     agagggcctt tgaagtcgct gttgaaccgc cgacttgtat gggggtag                    288
//

If you have problems or comments...

PBIL Back to PBIL home page