(data stored in ACNUC7421 zone)

EMBL: BA000030.PE306

BA000030.PE306       Location/Qualifiers
FT   CDS_pept        complement(355951..357105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_304"
FT                   /old_locus_tag="SAV_304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_304"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68013"
FT                   /db_xref="GOA:Q82R40"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R40"
FT                   /protein_id="BAC68013.1"
FT                   /translation="MIDTPIRTYIAQHTDGLAVSGSAVYAFWQAVGLFGLVGGFFHSTG
FT                   ARITYSLWGAASVGMVWSASPADGRTVATGIAVLAWTIASVFALRGLSLRPVIHTAFQP
FT                   HIALLGIAAPALLRSTAALRTGLLVLAASLSLMPLTHDSGAWWALRLIAGAASALVFMI
FT                   ATSAMLAGLAAHMTGWAFGGVGAGIALSGLMVVAVQQAGSWQTAWFACAVLTVLLTVAA
FT                   WNLVPRGAAATAPAATAAAERPRTHRWFTALLTSYVLEGIGYIIAGTFLVAALQQGAPG
FT                   WIGSGAWIVVGLAALPSCAVWMRLARLHRTHETPGHNHNLRSLPNPGCLCVLSSPMGRE
FT                   GLGFSLVGDHDAPHVVGQAAFQAPLRFLRRLTLREFALVVRVSG"
     gtgatcgaca ccccgatccg cacgtacatc gcccagcaca ccgacggcct cgccgtcagc        60
     ggatccgccg tctacgcctt ctggcaggcg gtcggcctgt tcggcctggt cggcggcttc       120
     ttccacagca ccggcgctcg catcacctac agcctctggg gagcggcaag cgtcggcatg       180
     gtgtggtccg cctcccccgc cgacggccgc accgtcgcca ccggcatcgc cgtcctcgcc       240
     tggaccatcg cctccgtctt cgccctgcgc ggcctgagtc tgcgcccggt catccacacc       300
     gccttccagc cccacatagc cctgctcggc atcgccgccc ccgcgctgct ccgctcgacg       360
     gccgccctgc gtaccggact gctggtcctg gccgcgtccc tatctctgat gcccctgacc       420
     cacgacagcg gcgcctggtg ggcactgcgg ctgatcgcgg gcgcggccag cgccctcgtc       480
     ttcatgatcg ctacgagtgc catgctggcc gggctcgccg cgcacatgac cggctgggcc       540
     ttcggcgggg tcggcgcggg tatcgccctg tccgggctga tggtggtggc ggtgcagcag       600
     gccggctcct ggcagacggc ctggttcgcc tgcgccgtgc tcaccgtgct gctgaccgtc       660
     gccgcttgga atctggtccc acgcggcgcg gcggccacgg ctcccgccgc caccgctgcg       720
     gccgaacggc cgcgcacgca ccgctggttc accgccctgc tgaccagtta cgtccttgag       780
     ggcatcgggt acatcatcgc cggcaccttc ctggtcgccg ccctccagca aggtgccccc       840
     ggctggatcg gcagcggcgc ctggatcgtg gtcggcctgg ccgcgctgcc ctcgtgcgca       900
     gtgtggatgc gtctggcccg gctacaccga actcacgaaa ccccaggtca caaccacaac       960
     ctgagatctc taccgaaccc ggggtgcctc tgtgtcttgt caagtcccat gggcagggag      1020
     ggacttggct tttcgctcgt cggcgatcat gacgcgccac acgtggtcgg ccaggcggcg      1080
     tttcaggcac cgcttcgctt ccttcgccgt cttaccctca gagagtttgc gctggtagta      1140
     cgcgtgtccg ggtga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page