(data stored in ACNUC7421 zone)

EMBL: BA000030.PE31

BA000030.PE31        Location/Qualifiers
FT   CDS_pept        38623..39624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_31"
FT                   /old_locus_tag="SAV_31"
FT                   /product="putative prepilin peptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_31"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67740"
FT                   /db_xref="GOA:Q82RW1"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RW1"
FT                   /protein_id="BAC67740.1"
FT                   /translation="MGRPSPAAHVVPQDVRDLTPLNGRNRAMTQHDPPTLPAHRPRASR
FT                   QAPEAPDAPSLSRTTRPWMPALLYTLGFLTVYLLAICTPWGQRAENALFGLGKQGGEEA
FT                   WFYPLSGAAYGSTPLPPLELSAKPTLMVGLAVIVVLTLVRRCWWPGCAALGVVILTTGG
FT                   KEVLKSTLPRPDLVGAPENLLDQGFPSGHTAIPAALTLAAVLVVSPRIRPYVATAGVLW
FT                   LACIAAYSATNGGHRPSEVLGATLLACACYGLATWLLPPSAAPGATRSPRALPVITLTL
FT                   ALAVALVSGARNDTLTRSLVSAATGFICAALVWYAAVGRPAHTARRTRPALG"
     gtgggccggc cgagcccggc ggcccacgtc gtgccacaag acgtgcgtga cctaactccc        60
     ctcaacggaa gaaacagagc gatgactcag cacgatcctc cgaccctgcc cgcgcaccgt       120
     ccgcgggcct caagacaggc ccccgaggcc cccgacgcac ccagcctgtc gcgtacgaca       180
     cggccgtgga tgccggctct gctgtacacc ctggggttcc tgacggtcta cctgctcgcc       240
     atctgcaccc cgtgggggca acgagctgag aacgccctgt ttggtctcgg taaacaaggc       300
     ggcgaagaag catggttcta ccccctgtca ggagcggcct acggctcgac gcccctgccg       360
     ccgctggaat tgagtgccaa gcccaccctg atggtgggcc tggccgtcat cgtggtcctc       420
     accctggtgc ggcggtgctg gtggccgggg tgcgcggcgc tcggggtcgt cattctcacg       480
     accggaggca aggaggtgct caaatcgacc ctgccccgcc ccgatctggt gggcgcgccc       540
     gagaatctcc ttgatcaggg gttccccagc gggcacacgg ccatccccgc cgcgctgacc       600
     ctcgccgccg tcctcgtggt ttccccccgc atccgcccct acgtcgccac ggccggtgtg       660
     ctgtggctcg cctgcatcgc cgcctacagc gcgaccaacg gcggccaccg gcccagcgaa       720
     gtgctggggg ccacactatt ggcctgtgcc tgttacggcc tcgcaacctg gctgctgccg       780
     ccgtccgccg cgccgggcgc cacgcggagc cctcgagcgc tgcccgtcat caccctgacg       840
     ctggcactgg ccgtcgccct cgtttccggc gcacgcaacg acaccctcac aaggtcactg       900
     gtctccgcgg cgacgggctt catatgtgcg gccctggtct ggtacgccgc agtcgggcgg       960
     cctgcacaca ccgcacgccg cacacgcccc gcactgggct ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page