(data stored in ACNUC7421 zone)

EMBL: BA000030.PE325

BA000030.PE325       Location/Qualifiers
FT   CDS_pept        complement(380736..381536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_322"
FT                   /old_locus_tag="SAV_322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_322"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68031"
FT                   /db_xref="GOA:Q82R23"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R23"
FT                   /protein_id="BAC68031.1"
FT                   /translation="MIAEDTQPPAHGREFQPRPDTTDALSTPVVDAPASATGQLAARQP
FT                   AAGLEGGVERATAALKPRLRGWLHAGVFPLALVGGIVLIAVSRSAAAVAACSVYALSAC
FT                   LLFGTSAVYHRGTWGARGEAVLRRMDHANIFLIIAGTYTPLAVLLLPGGEQLVLLAVVW
FT                   AGALAGIAFRVLWIGAPRWLYTPCYIVLGWVAVFYLPDFARTGGTAVVALVIAGGLLYT
FT                   AGAVVYGLKRPDPLPAWFGFHEVFHALTIAAFTAHYTAILLAAT"
     atgatcgccg aagatactca gccgcccgca cacggacggg agttccagcc ccgccccgac        60
     accaccgacg ccctgtccac ccccgtggtt gatgcgcctg ccagcgctac cggccagctc       120
     gctgcccggc agccagccgc cggcctggaa ggcggggtgg agcgggcgac ggctgcgctg       180
     aagccgaggc tgcgcggctg gctgcacgcc ggcgtgttcc ccctcgcgct ggtcggcggc       240
     attgtgctga tcgccgtttc gcgttcggct gcggcggtgg cggcgtgctc ggtgtacgcg       300
     ttgtcggcct gcctgctgtt cggtaccagc gcggtctatc accgcgggac gtggggtgcg       360
     cgcggggagg cggtcctgcg gcggatggac cacgcgaaca tcttcctcat catcgccggc       420
     acgtacaccc cgctggcggt actgctgctg cccggaggcg agcagttggt gctgttggcc       480
     gtggtgtggg cgggcgcctt ggccggcatc gccttccgcg tgctgtggat cggggctccc       540
     cgatggctgt acaccccgtg ctacatcgtc ctgggctggg tggccgtctt ctacctgccc       600
     gacttcgcac gcaccggcgg caccgcggtc gtcgcactgg tcatcgccgg aggtctgctc       660
     tacaccgcgg gcgccgtcgt ctacggcctc aagcgccccg accccttgcc ggcctggttc       720
     ggctttcacg aggtcttcca cgccctgacc atcgccgcct tcaccgcgca ctacacggcc       780
     atcctcctgg cagccacata a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page