(data stored in ACNUC7421 zone)

EMBL: BA000030.PE328

BA000030.PE328       Location/Qualifiers
FT   CDS_pept        complement(383431..384198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_325"
FT                   /old_locus_tag="SAV_325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_325"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68034"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R20"
FT                   /protein_id="BAC68034.1"
FT                   /translation="MSMVGGQWPGAVERLAQQLGAAQAADRRVKEAKATAARQSPSSTG
FT                   LERAEYQRRLRAHVQTPEHKAAAHAISVAVALMKAHDAALLRSAHTLLARRANGQRLPR
FT                   RLPRPLVLPGGYAPQWWISSIDSTYAGIWRAIPSPGPELRLGSPNDPLVQEVAKQARLL
FT                   QASRVGYRGRDDLYEAFHPDGTREGGEPVPPIRGLSPETSRRTNLALGRGDGIRIQPSR
FT                   MEEAGQMHTDYFAVWDRSRAYAAAVLALLRAHA"
     gtgagcatgg tggggggcca gtggccggga gccgtcgaac ggcttgcgca gcaactcggc        60
     gcagcccagg cggccgaccg gcgtgtgaaa gaggcgaagg cgaccgcggc tcgccagagc       120
     ccgagcagca ccggccttga acgcgccgag taccagcgcc ggctgcgcgc gcacgtacag       180
     acccccgagc acaaggcggc ggcccacgcc atcagcgtcg ccgtggccct gatgaaggcg       240
     cacgacgctg ccctgctgcg ttcggcacac acactgcttg cccggcgcgc caacggacag       300
     cgcctacccc gacggttgcc gcggccgctc gtattgcccg gcggttatgc gccccagtgg       360
     tggatcagca gcatcgattc cacgtacgcg ggcatctggc gggcgatccc gtcccccggg       420
     ccggagctcc ggctcggcag ccctaatgac ccgttggtgc aggaggtcgc caagcaggca       480
     cggctgctgc aggccagccg tgtgggttac cgagggcgcg acgacctgta cgaggctttt       540
     caccccgacg gcacgcgcga gggcggcgag ccggtaccgc cgatccgcgg cctgagcccg       600
     gagacgagcc gccgcaccaa ccttgcactc ggccgcggcg acggcatacg catccagccc       660
     tcccggatgg aggaggccgg tcagatgcac accgactact tcgccgtctg ggaccgatcc       720
     cgcgcgtacg cggccgccgt gctcgccctg ctgcgggccc acgcgtaa                    768
//

If you have problems or comments...

PBIL Back to PBIL home page