(data stored in ACNUC7421 zone)

EMBL: BA000030.PE33

BA000030.PE33        Location/Qualifiers
FT   CDS_pept        complement(41665..41967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_33"
FT                   /old_locus_tag="SAV_33"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_33"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67742"
FT                   /db_xref="InterPro:IPR029476"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RV9"
FT                   /protein_id="BAC67742.1"
FT                   /translation="MTKERNEPSANPLRVGLKAALGGLRTVLPSGSQCDEYPFATTYEG
FT                   AAEYDYDPDARKFNFSVRPIAKADNGAGGSLLLSFYAKNRLIDGLEDGFGVKIVS"
     gtgacgaaag aaagaaatga gccgtcagcg aatcccctcc gggtcgggct gaaggctgcc        60
     ctcggcggac tgaggacggt ccttccctcc ggctcgcagt gcgacgagta ccccttcgcc       120
     accacctacg aaggtgccgc cgagtacgac tacgaccctg acgcgagaaa gttcaacttc       180
     tccgtgcgtc cgatcgcgaa ggcggacaac ggggcaggcg gcagcctgct gctcagcttc       240
     tacgcgaaga accgcctcat tgacggcctc gaggacggat tcggcgtgaa gatcgtctcc       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page