(data stored in ACNUC7421 zone)

EMBL: BA000030.PE331

BA000030.PE331       Location/Qualifiers
FT   CDS_pept        386768..387076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_328"
FT                   /old_locus_tag="SAV_328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_328"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68037"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R17"
FT                   /protein_id="BAC68037.1"
FT                   /translation="MGDRDEGADVAEPVAVEFTAPASSSRSTAYSTTAWRTRPTRRVTH
FT                   TAVPRLYAEMVAKDRRLRLAGYEIYRFGGFELTAPGGEQILAAFFTELLGRHRKPPL"
     gtgggtgatc gcgatgaggg cgcggatgtg gcggagccgg ttgcggtcga gttcaccgct        60
     cccgcatcgt catcgaggtc gacggcgtac agcactacgg cctggagaac ccgcccgacg       120
     agaagggtca cccacactgc cgtgccgcgg ctgtatgcgg agatggtcgc caaggaccgg       180
     cggctgcgcc tggccggcta cgagatctac cgcttcggtg gtttcgagct caccgcgccg       240
     ggcggcgagc agatcctcgc ggccttcttc accgaactcc tcggtcggca caggaagccg       300
     cccctgtga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page