(data stored in ACNUC7421 zone)

EMBL: BA000030.PE332

BA000030.PE332       Location/Qualifiers
FT   CDS_pept        387129..387536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_329"
FT                   /old_locus_tag="SAV_329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_329"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68038"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R16"
FT                   /protein_id="BAC68038.1"
FT                   /translation="MREEAEQVQAALGASERALQRLVDARATVAEVLAEPPSVVAEPVS
FT                   GAVAGAVVPRRTGDMAASVLAPDYQQILSVLESEAGREGMRCQQLAVALGLQAVPAKVE
FT                   GLRSKAKRLVERGWALQVRPGVFTALAMPTV"
     ttgcgggagg aggccgagca ggtgcaggcc gcgctcggcg cctcggagcg cgcgcttcag        60
     cggctggtgg atgcccgtgc aacggtggcc gaggtactgg ccgagccgcc ttccgtagtc       120
     gcggagccgg tgtctggcgc ggtggcgggg gcggtggtgc cgcggcggac cggggacatg       180
     gccgcgtcgg tcctcgcgcc ggactaccag cagatcttgt cggtgctgga gtcggaagcg       240
     gggcgggagg gcatgcgctg ccagcagctg gccgtggccc tggggcttca ggcggtcccg       300
     gcgaaggtgg aggggctgcg gtcgaaggcg aaacgcctgg tggaacgggg gtgggcactc       360
     caggtgcggc cgggagtgtt caccgcgctc gcgatgccga ccgtctga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page