(data stored in ACNUC7421 zone)

EMBL: BA000030.PE333

BA000030.PE333       Location/Qualifiers
FT   CDS_pept        complement(387639..387947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_330"
FT                   /old_locus_tag="SAV_330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_330"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68039"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R15"
FT                   /protein_id="BAC68039.1"
FT                   /translation="MNAWRMLAPEIHPTPKSTKHVGRAQVVIGGTARETQVRFDAEARA
FT                   WATTGPTTTAKNRAAVPAQPGPTQLQKPTAPAALPVRSDSSRRCRSDWDKAIGHLQG"
     atgaacgcct ggcgcatgct cgctcccgag atccatccca cgccgaagtc caccaagcac        60
     gtcggccgcg cccaggtcgt catcggcggc accgcgcggg agacgcaggt gcggttcgat       120
     gccgaagccc gcgcgtgggc caccaccggc ccgaccacca ccgcgaagaa ccgcgccgct       180
     gtccccgccc agccaggacc gacgcagctg cagaagccga ccgcccccgc cgccctgccc       240
     gtgcgtagtg actccagcag gcgttgtagg tcagactggg acaaggccat cgggcacctc       300
     cagggttga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page