(data stored in ACNUC7421 zone)

EMBL: BA000030.PE335

BA000030.PE335       Location/Qualifiers
FT   CDS_pept        complement(388386..388766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_333"
FT                   /old_locus_tag="SAV_333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_333"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68041"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R13"
FT                   /protein_id="BAC68041.1"
FT                   /translation="MGCPTARGARAADTHLRFSRDLVADLITQKLALEGVTFSWHPAER
FT                   KPYVLVKKTRKSPAEAAFKDPKVRDLVAKAAEPAPIIGSGGKPVSVDLDADSPHILVYA
FT                   STVGGKSVILRCIACQMIHRGS"
     gtgggttgtc ccactgcacg aggcgctcgc gcagccgaca cgcacctgcg gttctcccgc        60
     gacctggtcg ccgacctcat cacccaaaaa ctcgccctgg agggcgtgac gttctcctgg       120
     cacccggccg aacgcaagcc gtacgtgctg gtgaagaaga cccgcaagtc tccggcggag       180
     gccgccttca aggaccccaa ggtgcgcgac ctggtggcca aggctgcgga gcctgcgccc       240
     atcatcggct ccggcggcaa gccggtctcc gtcgacctgg atgccgattc gccgcacatc       300
     ctggtctacg cctccaccgt cggcggcaag tcggtcatcc tgcgctgcat cgcctgccag       360
     atgatccacc gtggctcgta g                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page