(data stored in ACNUC7421 zone)

EMBL: BA000030.PE337

BA000030.PE337       Location/Qualifiers
FT   CDS_pept        389084..389704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_334"
FT                   /old_locus_tag="SAV_334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_334"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68043"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R11"
FT                   /protein_id="BAC68043.1"
FT                   /translation="MRLFADHVSGPPSAERFAGPLWLRERPGGLNEIEWRLRPGLPAFV
FT                   LYHARMTSSMSLLLACCGNAFDSTLAAMREGTEEHLPKEMAKHWTSFAHMVANGQRGDL
FT                   SDLGITLVTDPVDGVKGGCVATIVSPRGSESELKDALTRVIRGAASAIGEGVEAAERSP
FT                   RIHGLLAAQSDHAVLDDRLETIAATGFRFGATRSLLDLDWPTE"
     gtgcgtctgt tcgccgatca tgtctcgggt ccgccgtccg ctgagcgatt cgccgggccg        60
     ctgtggttgc gggagcggcc cggtggactc aatgagatcg aatggcggct gcgtcccggt       120
     ttgcccgcgt ttgtgcttta tcacgccagg atgacgtcgt cgatgtccct gttgttggcc       180
     tgctgcggca acgcgttcga ctcgactttg gccgcgatgc gggaaggcac cgaggagcat       240
     ttgcccaagg agatggcgaa gcactggacg tccttcgcgc acatggtggc caatgggcag       300
     cgaggcgatc tctccgatct cgggatcacg ttggtcaccg accccgttga cggtgtgaag       360
     ggtggttgtg tcgccacgat cgtgagcccc cgcgggagcg agagcgagct gaaagacgcc       420
     ctgacccggg tgatcagggg agcggcctcc gcgatcgggg agggggtgga ggcggctgag       480
     cgttcacccc ggatccacgg gctgctggcc gctcagtcgg atcacgcggt gctggacgac       540
     cggctggaga ccatcgccgc gaccgggttc cgtttcggcg ccaccaggtc cctgctcgac       600
     ctggactggc ctacagaatg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page