(data stored in ACNUC7421 zone)

EMBL: BA000030.PE34

BA000030.PE34        Location/Qualifiers
FT   CDS_pept        42010..44046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_34"
FT                   /old_locus_tag="SAV_34"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_34"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67743"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RV8"
FT                   /protein_id="BAC67743.1"
FT                   /translation="MGFVHLFPQRGRRLISLTARTTGRRRLALGTILAIVIGSGATGTA
FT                   YSADGSDNPPPVHGPGARAAAAAEPDTPNGPEVGPPFTKTNNVWQTDTTTPTLRNTVTA
FT                   PSGHKTTATFEVHTTDSSGKPTATVVKLTDENQWGVLVSGEVTAGKPASVTVPAGKLKN
FT                   GVTYAVRSSGYDATSNVYESDWSPYSTFKINVPPAEKPYVTFPAPQATSGIDSLAQTPI
FT                   EFTRTDPGPVTGLRGDDNGRKCSAPDAEGRKVCIEISRDAPTPEDAAVAKGAMRQALRG
FT                   ADLVSWCAAKPDGKDYMNRGEACLKKVGYATLIFVDADDLPRFGTATFALSQQIKLYNK
FT                   KSDTGTDRAEFDQQLTVVPTQIDDATEGVHLTWQPGDNCKDCTSSQVQWSSNDGLNTTP
FT                   HWAVGEVGAQYAMTAKRQTIWNGTGKEQFDLGWSLLGSVDAGNAHAQTSLGTSGDVRVR
FT                   ELAPRCDDIAGGNIKTGCVFPYFKPTWTVDTNLYPAAGAYYWLLQEKLPSHPGSRKWDS
FT                   LVTYLGPGNNADPDGGDWTNDDSRGIVCPTGTSGFKPNPATPDGSCDEYAPASTYQSGG
FT                   MPKGPNQVASGKECAQLYTKPMTGGTWGLLAENRDGYTGPKWNEKCGRASVPTDQNTGA
FT                   FRDLGIKFVPQMRLLDKDGFFISDPGFEHCKNADTVCAWKKVG"
     atgggattcg tacatctgtt cccacagaga ggtcgcaggt tgatatccct caccgcaaga        60
     accacaggaa gacgtcgctt agccctcggc acgatcctcg cgatcgtcat cggatccggt       120
     gccaccggca ccgcctactc ggccgacggc tccgacaacc cgccgcccgt ccacggcccc       180
     ggggcacggg cagctgcggc cgccgagccg gacactccca acggccccga agtcggcccg       240
     ccgttcacga agaccaacaa cgtgtggcag accgacacca ccacaccgac gttacgcaac       300
     acggtcactg cccccagcgg ccacaagacc accgcgacct tcgaagttca caccaccgat       360
     tccagcggca aacccacggc cacggtcgtc aagctgaccg acgagaacca gtggggcgtc       420
     ctcgtctccg gcgaggtgac cgccggcaaa ccggcctccg tcacggttcc ggccggcaag       480
     ctcaagaacg gtgtcaccta cgcggtccgc tcttccgggt acgacgccac cagcaacgtg       540
     tacgagagcg actggtcccc gtactccacc ttcaagatca acgtcccccc ggccgagaag       600
     ccgtacgtca ccttcccggc accacaggcc acgtccggca tcgactcact tgcgcagact       660
     ccgatcgaat tcacgcgtac cgatcccggc ccggtcacgg gactgcgcgg cgatgacaac       720
     ggccggaaat gctccgcccc ggacgccgag gggcggaagg tgtgcatcga aatcagtcgt       780
     gacgcgccga ctcccgaaga cgcggcggtc gccaagggag cgatgaggca agctcttcgg       840
     ggcgccgatc tcgtctcgtg gtgcgccgcg aaaccggacg gcaaggacta catgaaccgg       900
     ggcgaggcgt gtctgaagaa ggtcggctac gcgaccctga tcttcgtcga cgccgatgac       960
     ctgccgaggt tcggcaccgc cacgttcgcg ctgtcccagc agatcaagct gtacaacaag      1020
     aagtcggaca ccggcacgga ccgtgcggag ttcgaccagc agctcaccgt ggtcccgacg      1080
     cagatcgacg acgcgaccga gggcgttcac ctcacctggc agccgggcga caactgcaag      1140
     gactgcacca gctcgcaagt ccagtggtcg agcaacgacg gcctcaacac cacgccgcac      1200
     tgggcggtcg gcgaggtcgg cgcccagtac gccatgaccg cgaagaggca gacgatctgg      1260
     aacggcaccg gcaaggagca gttcgacctc ggctggagcc tcctcggttc cgtcgacgct      1320
     ggcaacgctc acgcgcagac cagcctcggc accagcggcg acgtccgtgt ccgggaactg      1380
     gcgccacgct gtgacgacat cgccggaggc aacatcaaga ccggctgtgt cttcccgtac      1440
     ttcaagccca cctggacggt cgacaccaac ctgtacccgg cggccggcgc ctactactgg      1500
     ctgctgcagg agaaactccc ctcccacccc ggcagccgga agtgggattc cctcgtcacc      1560
     tacctcggcc ccggcaacaa cgccgatccg gacggcgggg actggaccaa cgacgacagc      1620
     cgcggcatcg tctgccccac agggaccagc ggtttcaagc ccaaccctgc cacgcccgac      1680
     ggatcgtgcg acgagtacgc gcccgcaagt acgtaccaga gcggcggcat gccgaagggg      1740
     ccgaaccagg tcgcctccgg gaaagaatgc gcacagctct acaccaaacc catgaccggc      1800
     ggcacgtggg gactgcttgc agaaaaccgc gacggctaca ccggcccgaa gtggaacgaa      1860
     aagtgtggtc gtgcctccgt tcccacggat cagaacactg gcgccttccg cgacctcggc      1920
     atcaagttcg ttccccagat gcggctgctc gacaaggacg ggttcttcat cagtgatcct      1980
     ggcttcgagc actgcaagaa cgccgacacg gtctgcgcgt ggaagaaggt cggctga         2037
//

If you have problems or comments...

PBIL Back to PBIL home page