(data stored in ACNUC7421 zone)

EMBL: BA000030.PE343

BA000030.PE343       Location/Qualifiers
FT   CDS_pept        complement(395736..397091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_340"
FT                   /old_locus_tag="SAV_340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_340"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68049"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R05"
FT                   /protein_id="BAC68049.1"
FT                   /translation="MHGSSRQVGRSSTGQPGAPPQPPCAHPPGAPGGIHPLPLEAYVST
FT                   TAVSTSPGPVPPVPDADEVFAFAAREIAAAAAGLWPRADVDLGDHVPSVTGYVRRIRVD
FT                   GRTLYAKYAFLGVSLVSLLRGACGPWPDVRAAQQAYVQRPGALMDREAAQLRLLAQLDS
FT                   PRVCPVAGLARGVLFTESVTGPTLADLLLQRPHDAADLLEGLFGELRRLHRPSAARLLG
FT                   PARGIGEHSIRGTFQRKFNGLSGPTYVERLGAERCAPGDRALVVGLLRDVVVRLHRLQA
FT                   TGLPQQASRRVLAYGDLKPEHVVFPEGTSGQPVFIDPGLLLAPPTVDAAKLISRTVLLL
FT                   AAARPGAGTGQQAMRGVGAFAAARADVLPARVRRSWLRELLVLWLMDSVNILTTYLSAP
FT                   GVLPMPGRGSALIGRAVDLCRMADQLSSELAAGADTRAVWESALGLAQAVAA"
     gtgcacggga gctcccggca ggtgggccgc tcctcaactg gccagccggg ggctcctccc        60
     cagccaccat gcgcccaccc gcccggggca ccgggcggga ttcatccact gccgttggag       120
     gcgtacgtga gcaccacagc cgtgagcaca tcgcccggtc ccgttccccc cgtcccggac       180
     gccgacgagg tgttcgcctt cgccgcccgg gagatcgctg ccgctgccgc cggcctgtgg       240
     ccgcgcgccg acgtcgacct cggcgaccac gtcccgagcg tcaccggcta cgtgcgccgg       300
     atccgcgtgg acgggcgcac cctgtacgcc aagtacgcct tcctcggggt gtcgctggtc       360
     tcgctcctgc ggggcgcctg cgggccctgg ccggatgtcc gggcggcgca gcaggcgtac       420
     gtgcagcgtc ccggcgcgct gatggatcgg gaggccgcgc agctgcggct cctggcccag       480
     ctggactcgc cccgggtctg tcccgtggcc ggcctggcgc gaggggtgct gttcaccgag       540
     tcggtgaccg gcccgaccct ggccgacctg ctcctgcagc gtccgcacga tgcggccgat       600
     ctcctcgagg gcttgttcgg tgagctgcgg cggcttcacc gcccgtcggc ggcccggcta       660
     ctgggcccgg cccggggcat cggggagcac agcatccggg ggaccttcca gcgcaagttc       720
     aacggactga gcggcccgac gtatgtggaa cggctcgggg ccgaacggtg cgcgcccggc       780
     gatcgcgccc tggtcgtcgg gctgctgcgc gacgtcgtgg tccggctgca ccggctccag       840
     gccacggggc tgccccagca ggcgagccgg cgggtgctgg cgtacgggga cctcaagcct       900
     gagcacgtgg tgttccctga aggaacatcc ggtcagccgg tgttcatcga ccccggcctg       960
     ctgctcgccc cgcccacggt ggatgccgcg aagctgatca gccgaaccgt gctgctgctg      1020
     gccgctgccc ggcccggcgc cgggacgggc cagcaggcca tgcgcggggt cggcgccttc      1080
     gccgcggcgc gggcggacgt cctacccgcc cgggtccgcc gctcctggct gcgggagctg      1140
     ctggtgctgt ggctgatgga cagcgtcaac atcctgacca cgtacctgtc cgcgcccggc      1200
     gtactgccga tgcccggtcg gggcagcgct ctcatcggcc gggccgtcga cctgtgccgg      1260
     atggccgatc agctcagctc ggagctggcg gccggcgccg atacgcgcgc cgtgtgggag      1320
     agcgcgctcg gcctggctca ggcggtcgcc gcgtga                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page