(data stored in ACNUC7421 zone)

EMBL: BA000030.PE344

BA000030.PE344       Location/Qualifiers
FT   CDS_pept        complement(397379..397615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_341"
FT                   /old_locus_tag="SAV_341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_341"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68050"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R04"
FT                   /protein_id="BAC68050.1"
FT                   /translation="MSTKRSLLHRDHPWIGRDVEDTATGRRGVLRAIAPDGDRPRPVAW
FT                   LLPAGGGMEWTTDPGALANPAPLTADMHPKEER"
     gtgagcacca agcgcagcct gctgcatcgc gatcacccgt ggatcggccg ggacgtcgag        60
     gacaccgcga ccggccgtcg gggggtcctg cgggccatcg ccccggacgg cgaccggcca       120
     cgcccggtgg catggctgct gccggcgggc ggcgggatgg agtggaccac ggacccgggc       180
     gcgctagcca accccgcgcc cctcacggcg gacatgcacc ccaaggagga gcggtga          237
//

If you have problems or comments...

PBIL Back to PBIL home page