(data stored in ACNUC7421 zone)

EMBL: BA000030.PE345

BA000030.PE345       Location/Qualifiers
FT   CDS_pept        complement(397612..398019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_342"
FT                   /old_locus_tag="SAV_342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_342"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68051"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R03"
FT                   /protein_id="BAC68051.1"
FT                   /translation="MTRTPDTRENITVAASASAAVLYVCAERSKLTPTLAADRAEAEGR
FT                   DFAEARGLTITEVVTDPYGDPDPCHRDGWLRVRELAESGAVRVVIVRWPACIAPEPSHE
FT                   LRHREIRWLQDHCVQVRYSWEPLATGGGEAK"
     atgaccagga cgcctgatac ccgggagaac atcaccgtcg ctgcttctgc cagcgccgct        60
     gtgctgtacg tgtgcgctga gcgaagcaag ctcactccca cgctcgcagc cgaccgtgcc       120
     gaggccgagg ggcgcgactt cgccgaggcg cgcgggctga cgatcacaga agtggtcacg       180
     gacccgtacg gcgatcccga cccttgccac cgtgacggat ggctgcgggt gcgggagctg       240
     gcggagtccg gcgcggtccg agtggtgatc gtccggtggc ccgcgtgtat cgctccggag       300
     ccctcccacg agctgaggca ccgcgagatt cgctggctgc aggatcactg cgtacaggtg       360
     cggtactcct gggagccgct ggccacgggc ggcggtgagg ccaagtga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page