(data stored in ACNUC7421 zone)

EMBL: BA000030.PE346

BA000030.PE346       Location/Qualifiers
FT   CDS_pept        398215..399555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_343"
FT                   /old_locus_tag="SAV_343"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_343"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68052"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R02"
FT                   /protein_id="BAC68052.1"
FT                   /translation="MARRPRTPNAALAALMQSGGIGNAQLARRVNAAGRELGLRMHYDK
FT                   TSVSHWLAGSVPKLEARPAVTEALSRLLGRPVTCAEVGWETEEKPAGERDFVAGVIDLS
FT                   RADMDPTRRGVLKTGMYAAALAVPRYEDVAGRLESATAGRTVHIGRSDVETVRTMTDKV
FT                   ADILDQVGAGHARPMAAAFLVNTAGPYLRASGTDEVQRDMRAAVADFVYLTGWMAMYED
FT                   QQGLGQTYYLRALELAGAAEDHVTYCRTLRGMSLQATHLGHGKKGLELADAAAEAAPSA
FT                   GPRLVAFLCGQQAAAAAMTNARNTALARLREAESALSRADDRRDAVGGYDQAAYFFHEA
FT                   HVRWHLGDKDGSIASLRRSNTARSPLERQGRLHCLGVTAERQFRMRHIEAACQTWGTFL
FT                   DEHVTISSARGDEHLKTMLKALPAYRRVAGVRELEERARHVATLKTA"
     atggcacgtc gaccgcgaac accgaatgca gcccttgcgg ccctgatgca gtcaggagga        60
     atcggaaacg cacagctcgc acgccgggtg aacgccgccg gccgcgaact ggggctccgc       120
     atgcactacg acaagacgag cgtgtcccac tggctcgccg gatccgttcc aaaactcgag       180
     gcaaggcccg ccgtcaccga ggcgctctca cggctgctcg gacggcccgt aacgtgcgcg       240
     gaggtcggct gggagaccga ggaaaagccg gccggagagc gcgacttcgt ggcaggagtg       300
     atcgacctga gccgggcaga catggatccc acacgccggg gagtgctgaa gaccgggatg       360
     tacgccgcgg cgctggccgt gccccgatac gaggacgtgg cggggcggtt ggagtcggca       420
     acggccgggc ggacggtgca catcggccgc tccgacgtcg agaccgtccg caccatgacc       480
     gacaaggtcg ccgacatcct ggaccaggtc ggggcaggcc acgcccgccc gatggccgcc       540
     gccttcctcg tcaacaccgc cggcccctac ctgcgcgcga gcggcacgga cgaggtgcaa       600
     cgcgacatgc gggccgctgt cgcggacttc gtgtacctca cgggctggat ggccatgtac       660
     gaagaccagc agggcctggg ccagacgtac tacctgcgcg ccctcgagct cgcgggcgct       720
     gccgaggacc acgtcaccta ctgccgcacc ctgcgcggca tgagcctgca ggcgacgcac       780
     ctaggccacg gcaagaaggg cctggaactc gccgacgccg ccgccgaggc ggcgccctcc       840
     gccggcccgc gcctagtcgc cttcctgtgc ggccagcagg ccgccgccgc tgcgatgacc       900
     aacgcccgga acaccgccct ggcccggctc cgtgaggcgg agagcgcgct gtcccgcgcc       960
     gacgaccgac gcgatgccgt aggcggatac gaccaggccg cctacttctt ccacgaggca      1020
     cacgtgcgct ggcacctcgg cgacaaggac ggctccatcg cctccctgcg ccgctcgaac      1080
     accgcccgct ccccgctgga acgccaaggc cgcctgcact gcctcggcgt gaccgccgaa      1140
     cgccagttcc gcatgcggca catcgaagcc gcctgccaga cctggggaac cttcctggac      1200
     gagcacgtca cgatctcctc tgcccgagga gacgagcacc tgaagacgat gctcaaggcg      1260
     ctccccgcct accgccgcgt cgccggagta cgggaactcg aagaacgcgc ccgccacgtc      1320
     gccactctca agacagcctg a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page