(data stored in ACNUC7421 zone)

EMBL: BA000030.PE348

BA000030.PE348       Location/Qualifiers
FT   CDS_pept        401070..401894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_345"
FT                   /old_locus_tag="SAV_345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_345"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68054"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R00"
FT                   /protein_id="BAC68054.1"
FT                   /translation="MYAAARQPEGEGQAAESRATGVYRERAERRRRTRGTGEARGDGWQ
FT                   RTEEDEQLLRLATRYSTLTLHQAAYACWGGRIEAARRRVRLMVEAGLLHRLAVADVGIR
FT                   LESEGRTVLSEREVHAAEAVPGRAAELLADLGVHQVPVGVRRGEILAVPVGARAVHWPD
FT                   LVVVLPGGRLAAFEVELTAKPAAALRTILRAYKQARRPVAYLATEPVVGQLQGGPGPGG
FT                   RWVNGVAQELELLPPGGPGPGADGHLQVRPFTAVDPAVARRTAQQAARLRGG"
     atgtacgcgg ccgcgcgcca accagaggga gaaggacagg cagcggagag cagggcgacg        60
     ggggtctacc gggagcgagc ggagcgccga cggcggacgc gaggaacggg cgaggcccgc       120
     ggcgacggct ggcagcgcac cgaggaggac gagcagctgc tgcggctggc cacccggtac       180
     agcacgctga cgctccacca ggccgcctac gcctgttggg gcggacggat cgaggccgcc       240
     cggcggcggg tgcggctgat ggtcgaggcc gggctgctgc accgcctggc cgtcgcggat       300
     gtcggtatcc ggctggagag cgaagggcgc actgtgctct ccgagcggga ggtgcacgcc       360
     gccgaagccg taccaggccg cgcggcggag ctcctggcgg accttggcgt gcaccaggtc       420
     ccggtcggcg tccggcgcgg ggaaatactc gctgtgcccg tcggggcccg tgccgtgcac       480
     tggcccgacc tcgtcgtggt gctgcccggc ggccgcctcg ccgcgttcga ggtcgagctc       540
     acagccaagc ccgcggccgc gctccggacg atcctgcgtg cgtacaagca ggcccggcgc       600
     ccggtggcct acctcgccac tgagcctgtc gtgggccagc tgcagggcgg ccccgggccg       660
     ggcggccggt gggtcaacgg tgtcgcccag gagctggaac tcctgccgcc gggcgggcct       720
     ggcccgggcg ccgacgggca ccttcaggtg cggccgttca ccgccgtcga cccggccgtg       780
     gcccgccgga cagcccagca ggccgcccgg ctacgaggtg gataa                       825
//

If you have problems or comments...

PBIL Back to PBIL home page