(data stored in ACNUC7421 zone)

EMBL: BA000030.PE352

BA000030.PE352       Location/Qualifiers
FT   CDS_pept        408998..409465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_349"
FT                   /old_locus_tag="SAV_349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_349"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68058"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QZ6"
FT                   /protein_id="BAC68058.1"
FT                   /translation="MQTFLPFPDFAASAAALDPRRLGKQRVEALQLLRGLMVPGYGWRH
FT                   HPAVRMWTGYEEALVRYGLEVCCVWTAAGRADTCAGSLMTDFTAHRADVGVRTQERLAA
FT                   DGELPPWLGNPAFHRSHRSALRRKDPGFYAPLFPDVPEDLPYVWPASDRSR"
     atgcagacgt tcctgccctt tcccgacttc gccgcatctg ccgccgcgct cgacccgcgg        60
     cgcctgggca agcagcgcgt cgaggcgctc cagttgctgc gcggtctgat ggttcccggc       120
     tacggctggc ggcatcaccc ggcggtgcgc atgtggacag gctacgagga ggcactggtg       180
     cgctacggcc tggaggtctg ctgcgtgtgg acggcggccg ggcgcgcgga cacgtgcgcc       240
     ggctccctga tgaccgactt cacggcccac cgagccgatg tgggcgtgcg tacgcaggag       300
     cggcttgcag cggacggcga gctgccaccg tggctgggca atcccgcgtt ccaccgaagt       360
     catcggtcgg cgctgcggcg caaggatccg ggcttctacg cacccctgtt cccggacgtc       420
     cccgaggacc tgccctacgt ctggcccgcc tcggaccggt ctcgctag                    468
//

If you have problems or comments...

PBIL Back to PBIL home page