(data stored in ACNUC7421 zone)

EMBL: BA000030.PE356

BA000030.PE356       Location/Qualifiers
FT   CDS_pept        414815..416212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_353"
FT                   /old_locus_tag="SAV_353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_353"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68062"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QZ2"
FT                   /protein_id="BAC68062.1"
FT                   /translation="MSLLHHDARHEAFDFTSHFREDLYTCLTRRGDTLFELCDAMLCED
FT                   GPVTSPVDLTLLAEHRRGHGALYDALNQGRIDAVRLRKALAMLPQPKAADGRLVLAVDV
FT                   SAWLRPDAPCSPDRLFCHVSGRSGRSSDQFIPGWPYSFVAALETARTSWCQLLDAVRLG
FT                   PDDDVAEVTAAQVRRVVTDLIGQGQWEDGDDDILVVFDAGYDAPRMAYLLDSLPVEVLG
FT                   RMRADRVMRRPAPSPKEYAVSYPQGGRPPKHGKEFRFARPDTWGDPDAETVQVTDRYGA
FT                   AKAMAWDRIQPRLTTRSAWIDHDSELPIIEGTLIRLQVDHLPGGGDPLPVWLWSSKTGM
FT                   TSTDVDLRWQAFLRRFDLEHTFRFVKQTLGWTRPRLRTPEAADRWTWLVIAAHTQLRLT
FT                   PARVRRGFRNLRPHLHSPARAPKPSTPGLTTTAPALFSSCRVAAAASSGPRTTVPAAGP
FT                   RPRSRAS"
     gtgagtctgc tgcatcacga tgcccggcac gaggcgttcg acttcacgtc ccactttcgg        60
     gaggacctct acacatgtct gacccggcgc ggtgacacgc tgttcgagct gtgcgacgcg       120
     atgctctgcg aggacggccc ggtgacctcg ccggtcgatc tgacgctgct ggccgaacac       180
     cggcgtgggc acggcgcgtt gtacgacgcg ctcaaccagg gccgcatcga cgcggtcagg       240
     ctgcgcaagg cgctggccat gctgccgcag cccaaggccg ccgacgggcg cctggtcctg       300
     gccgtcgatg tctccgcgtg gctgcgtccc gacgcgccgt gcagcccgga ccggctgttc       360
     tgtcatgtct ccggacgctc gggacgctcc tcggaccagt tcatccccgg ctggccgtac       420
     tcgttcgtcg ccgcgctgga gaccgctcgg acgtcgtggt gccaactgct ggacgcggtc       480
     cggctcggcc ccgacgacga tgtcgccgag gtcaccgccg cccaggtccg ccgtgttgtc       540
     actgacctga tcggccaagg acagtgggag gacggtgacg atgacatcct ggtcgtcttc       600
     gacgccggct acgacgcccc gcgcatggcc tacctcctcg acagcctgcc cgtcgaggtg       660
     ctgggacgga tgcgtgcgga ccgtgtcatg cgacggccgg caccttcgcc caaggagtac       720
     gccgtgtcct atccccaggg cgggcgaccg ccgaagcacg gcaaggagtt ccgcttcgcc       780
     aggcccgata cgtggggcga tcctgacgcg gagacggtgc aggtcaccga ccgctacggc       840
     gccgcgaagg cgatggcctg ggaccgtatc cagccccggc tcaccacccg cagcgcgtgg       900
     atcgaccatg acagcgaact ccccatcatc gagggcaccc tgatccgcct ccaggtcgac       960
     catctgcccg gcggcggcga cccactgccc gtctggctgt ggtcctccaa gaccggcatg      1020
     accagcacag acgtcgacct gcggtggcaa gcgttcttga ggcgcttcga tcttgaacat      1080
     actttccgtt ttgtaaagca gacgctcggc tggacccgtc caagactccg tactcccgag      1140
     gccgcagacc ggtggacgtg gctcgtgatc gcggcgcata cccagctccg gctcaccccg      1200
     gcccgcgttc gccgggggtt caggaacctc cgcccccacc tgcacagtcc agcccgtgca      1260
     cccaaaccct caactcctgg tttgaccacc accgccccgg cgttgttcag cagctgccgg      1320
     gtcgcggcgg cggcctcgtc cgggccgcgg acgacagtgc ccgctgcggg gccccggccg      1380
     cggtcgcgag catcctga                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page