(data stored in ACNUC7421 zone)

EMBL: BA000030.PE365

BA000030.PE365       Location/Qualifiers
FT   CDS_pept        complement(426615..427010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_362"
FT                   /old_locus_tag="SAV_362"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_362"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68071"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QY3"
FT                   /protein_id="BAC68071.1"
FT                   /translation="MACSGRVRARGRRRGGQKVMRSRSASSTERGCTATVVVTALLIVG
FT                   VSACGGEATVDCTGGSYTVECHPVAQPADSTPGTTVPAPALTPSGTCPSDWGEFYKAVH
FT                   NRSLDWACPLPSFLGPPPDTAAPLPSP"
     gtggcctgct cgggaagggt ccgcgccagg ggcaggagaa gagggggaca gaaggtcatg        60
     aggagtcggt ctgcgtcatc cacggaacga gggtgcaccg cgacggtcgt ggtgacggcg       120
     ttgctgatcg tcggtgtatc agcgtgcggt ggcgaagcga ccgtcgactg cacgggcggt       180
     tcgtacacgg tcgagtgcca tccggtcgcc caaccggccg acagcacccc cggcaccacg       240
     gtccccgcgc ccgcgttgac gccgtcgggg acatgcccat cggactgggg cgagttctac       300
     aaggcggtgc acaacaggag cctggactgg gcctgcccac tacccagctt cctcggccca       360
     cccccggaca ccgccgcgcc cctaccgtcc ccgtga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page