(data stored in ACNUC7421 zone)

EMBL: BA000030.PE366

BA000030.PE366       Location/Qualifiers
FT   CDS_pept        complement(427297..428631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_363"
FT                   /old_locus_tag="SAV_363"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_363"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68072"
FT                   /db_xref="GOA:Q82QY2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QY2"
FT                   /protein_id="BAC68072.1"
FT                   /translation="MAEALNGSFKAELIEHQGPWRDADQVERSVVQWVGWYNTERLHSA
FT                   LDCLPPRGIRDPALPISGSNERRLKPRKPAATKLGAAHNGLYVTALGLLLAQYTFCGYD
FT                   ASSHLSEETTQAQISAPRGIVRSIWVSWIAGFILLAGLTSAIQDYAGTQSSSTGVPPAQ
FT                   IFLDVLGADGAKALMLIVIVAQLFSGSAETAAASRMVFAFSRDGAIPFAATWRRVSPRT
FT                   KTPAAAVWLSVGSALVLAAPSLYSPTAYAAVTAINVIGITPGPPWRTRPRGSCGTAPSM
FT                   PSTPSATSTGTGPHSWPSTTPSSTAPPFGRSHLCGHQPEAGANPRIRSNPYTTSLDAAH
FT                   GYFAEGTRLTAVATLGGAAYRRYAQQTRRSSPPRAAGGGVMWIFLVLGLLPIVLLLWTF
FT                   AGQVNQQMDSQFAGEVIALSVHRVTLTTGMRTDYVLTTVGSSPCR"
     atggccgagg ccctcaatgg ttccttcaag gccgagctga tcgagcacca agggccctgg        60
     cgagacgctg accaggtcga acgttccgtc gttcaatggg tcggctggta caacaccgag       120
     cgcctgcact cagcactcga ctgcctcccc ccccgaggaa ttcgagaccc ggcactaccg       180
     atctcaggca gcaatgaacg ccgcctgaaa ccacgcaaac cggccgctac gaaactcggt       240
     gcagctcaca acgggttgta cgtaacggct ctggggctac tgttggcgca gtacacgttc       300
     tgcggctacg acgcctcctc gcacctgtcg gaggagacca cccaggccca gatatcggcc       360
     ccccgcggca tcgtccgctc catctgggtc tcctggatcg ccggcttcat cctgctggcc       420
     ggtctcacct ccgccatcca ggactatgcc ggaacccaga gcagctcgac cggtgtgccg       480
     cccgctcaga tcttcctcga cgtcctgggg gccgacggag cgaaagccct gatgctcatc       540
     gtgatcgtgg cccaactctt cagcggcagc gccgagaccg ccgccgcgtc ccgcatggtg       600
     ttcgccttct cccgcgacgg agcgatcccg ttcgctgcca cctggcgccg cgtcagccct       660
     cgcaccaaga cgcccgccgc cgccgtatgg ctgtccgtcg gctcggcgct cgtactggcc       720
     gcgccgtcgc tgtactcgcc gaccgcgtac gccgcggtga cggccatcaa cgtcatcggt       780
     atcacgcctg gtccgccctg gaggacaagg cctcggggaa gctgtgggac ggcgccctcg       840
     atgcccagca cgccttcggc gacctcgacg ggcaccggcc cgcactcctg gccgtccacg       900
     acgccgtcgt cgacggcacc gcctttcggg cggagccatc tatgcgggca tcagccagaa       960
     gccggagcaa acccccggat caggtcgaac ccgtacacca cttccctgga cgcagcccac      1020
     ggatacttcg cagagggcac gcgcctgaca gccgttgcca ccctgggcgg cgctgcatat      1080
     cggcgttacg ctcaacaaac gcggcggtcg tccccgccgc gggcggcagg cgggggagtt      1140
     atgtggatct tcttggtact gggtttgctg cccatcgttc tgctcctgtg gaccttcgcg      1200
     ggacaagtga accagcagat ggacagccag ttcgccggtg aggtgatcgc cctttcggtc      1260
     catcgcgtca cgctgaccac cggcatgcgc accgactacg tgctgacgac ggtcggcagt      1320
     tcaccttgca ggtga                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page