(data stored in ACNUC7421 zone)

EMBL: BA000030.PE371

BA000030.PE371       Location/Qualifiers
FT   CDS_pept        437259..438503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_368"
FT                   /old_locus_tag="SAV_368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_368"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68077"
FT                   /db_xref="GOA:Q82QX7"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QX7"
FT                   /protein_id="BAC68077.1"
FT                   /translation="MSPSIPGPRRAPARGRRAFAATWWGQAWVTALEDSTLDSGRLSRG
FT                   RTYARQGMVGPTTVAPGQVKAPVQGSRPRPYRCSVHLSVLTDTQWDTLLDTIAARAGHL
FT                   AALLGGEMPGELVDDARRAGVPLLPQSTELDPDCSCPDWGYPCKHAAALCYAIAATIDA
FT                   DPFVLFALRGRDREEVITQLRARRTAAQATSTPPAPAGLPAAGAYTAWGALADQPPSLP
FT                   ELPEPAPHTAALPAAPPPGTGLSAADLERLMADTAARAARLLTGDTTSLHLSQHEDAAR
FT                   IASSNCGPEWFHRLIQNTGAKPAAFARLTRAWRYGGPTGITVAEQPRTPDPTAMTAART
FT                   ALTETLTEMTTPPVALRAWRNRLTLADHGIQLRLGPDTRWYPYLQDDDGDWWPAAPADP
FT                   DPVTALTSVWQQTER"
     atgagtccct cgatccccgg tccgcgccgc gcgcccgccc gcggcaggcg cgccttcgcc        60
     gcgacctggt ggggacaggc gtgggtgacg gccctggagg actccaccct ggactcgggg       120
     cgcctgtccc gcggacgcac ctacgcccgc cagggtatgg tcggcccgac caccgtcgcc       180
     cccggccagg tcaaggcccc agtccagggc agccgcccgc gcccctaccg ctgctcggtc       240
     cacctgtccg tcctcaccga cacccagtgg gacaccctgc tcgacaccat cgcggcccgc       300
     gccgggcacc tcgccgcgct cctcggcggc gagatgcccg gcgaactcgt cgacgacgcc       360
     cgccgggcag gcgtccccct gctgccgcag tccaccgagc tcgacccgga ctgctcctgc       420
     cccgactggg gatacccctg caagcacgcc gccgcgctct gctacgccat cgcagccacc       480
     atcgacgccg acccgttcgt gctgttcgcc ctgcgtggcc gcgaccgtga ggaagtcatc       540
     acccagctgc gcgcccgccg tacggccgcc caggcgacct ccaccccacc ggccccggcc       600
     ggcctcccgg ccgccggcgc ctacacggcc tggggcgccc tggccgacca gcccccgtcc       660
     ctccccgaac ttcccgaacc ggcaccccac accgccgcac tgcccgccgc cccgccgccc       720
     ggcaccggac tgtccgccgc ggacctcgaa cgcctcatgg cggacaccgc cgcacgcgcc       780
     gcccggctac tcacgggcga caccaccagc ctgcacctgt cccagcatga ggacgcggcg       840
     cggatcgcct cgagcaactg cggacccgag tggttccacc gcctcatcca gaacaccggt       900
     gccaaaccgg ccgcgttcgc ccgcctcacc cgcgcctggc ggtatggcgg cccaaccggc       960
     atcaccgtcg ccgaacagcc acgcactccc gacccgaccg cgatgacagc cgcccgcacc      1020
     gccctgaccg agacgctcac cgaaatgacc acgcccccgg tcgccctcag ggcctggcgc      1080
     aaccgcctca ccctcgccga ccacggcatc cagctgcgcc tgggccccga cacccgttgg      1140
     tacccctacc tccaggatga cgacggcgac tggtggccgg cagcgccggc cgaccccgac      1200
     ccggtcacgg cactcacctc cgtctggcag cagaccgaga ggtga                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page