(data stored in ACNUC7421 zone)

EMBL: BA000030.PE384

BA000030.PE384       Location/Qualifiers
FT   CDS_pept        453216..454730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_381"
FT                   /old_locus_tag="SAV_381"
FT                   /product="putative phage tail sheath protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_381"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68090"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QW4"
FT                   /protein_id="BAC68090.1"
FT                   /translation="MTTQFSYPGVYIEEIESPVRPIAGAETSVTAFVGPALFGPTSPTT
FT                   VESWADFEKEFGGLWQGSELSYAVYQFFLNGGSKAIVVRVGEGVEYAGVDLKNGVKLKA
FT                   KAPGAAGKKLKATVTLDANDNKRYTLLISDGTTSESYDVTIDPALRNRWLDRQLATSQL
FT                   VERDTETFDKRPDAVTDESFTGGKDATFTPAHVLGDATKLPHTGLAALADVEIFNLLVI
FT                   PAQLAKPSGTDDRDTKWAPVVDAAVRLCEEQRAMLLLDPPFGWDSPETAVTGARAGMPV
FT                   GGLAGRNAAVFFPKVVISDPLSGGNLEVGPAGTVAGVIARTDTRRGVWKAPAGTDDGGL
FT                   LGVRSLAFRLSDQQNGTLNKLGVNCLRTVPVYGNVLWGSRTCRGGDAVSDPWKYIPVRR
FT                   VALHIEESLFIGTKWVVFEPNDEPLWSSIRLNIGAFMNRLFRQGAFQGPTAKGAYFVRC
FT                   DASNNPQDDINDGIVTIDVGFQPLSPAEFVHIRIQQKRDDATAQGS"
     atgacgacgc aattctccta tcccggtgtg tacatcgagg agatcgagag cccggtgcgg        60
     cccatcgccg gtgcggagac ctcagtgacg gcgttcgtgg gcccagcgtt gttcgggccc       120
     acgtcgccga cgaccgtgga gagctgggcc gacttcgaga aggagttcgg ggggctgtgg       180
     cagggcagcg aactgagcta cgcggtctac cagttcttcc tcaacggcgg cagcaaggcg       240
     atcgtggtcc gcgtcggcga gggggtcgaa tacgcggggg tcgacctcaa gaacggtgtc       300
     aagctcaagg cgaaggcgcc gggcgccgca ggcaagaagc tcaaggcgac cgtgacgctc       360
     gacgccaacg acaacaagcg ctacacgctc ctcatctccg acgggaccac ctcggagtcg       420
     tacgacgtga cgatcgaccc ggccctgcgc aaccgctggc tggaccggca gctcgccacc       480
     tcgcagctcg tggaacgcga caccgagacc ttcgacaagc ggcccgacgc cgtcacggac       540
     gagtcgttca ccggcggcaa ggacgccacc ttcacgcccg cacatgtgct gggtgacgcc       600
     accaagctgc cgcacaccgg cctcgcggca ctggccgacg tcgagatctt caacctcctg       660
     gtgatcccgg cccagttggc caaaccgtca ggcacggacg accgcgacac caagtgggcg       720
     cccgtcgtcg acgccgccgt tcggctgtgc gaggagcagc gggcgatgct gctgctggat       780
     ccaccgttcg gctgggactc accggaaacc gcggtgaccg gagcccgggc cgggatgccg       840
     gtcggcgggc tcgccgggcg caacgcggcc gtgttcttcc cgaaagtagt gatctcggac       900
     ccgctcagcg gtggaaacct cgaggtcggc ccggccggca cggtcgccgg ggtgatcgcc       960
     cgcaccgaca cccggcgcgg agtgtggaag gcaccggccg ggaccgacga cggcggcctg      1020
     ctgggtgtgc gctcgctggc cttccggctg tccgaccagc agaacggcac cctcaacaag      1080
     ctgggcgtga actgcctgcg caccgtcccg gtctacggga acgtgctgtg gggctcgcgc      1140
     acctgccgcg gcggcgacgc cgtgagcgac ccctggaagt acatcccggt caggcgggtc      1200
     gccctgcaca tcgaggagtc gctgttcatc ggcaccaagt gggtggtgtt cgagcccaac      1260
     gacgaacccc tgtggtcctc gatccggctc aacatcggcg cgttcatgaa ccggctcttc      1320
     cggcagggcg ccttccaggg gccgaccgcg aagggcgcgt acttcgtgcg ctgcgacgcc      1380
     tccaacaacc cgcaggacga catcaacgac ggcatcgtca ccatcgacgt gggcttccag      1440
     ccgctatcgc ccgccgagtt cgtccacatc cgtatccagc agaagcgcga cgacgcgacg      1500
     gcccagggga gctga                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page