(data stored in ACNUC7421 zone)

EMBL: BA000030.PE385

BA000030.PE385       Location/Qualifiers
FT   CDS_pept        454732..455262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_382"
FT                   /old_locus_tag="SAV_382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_382"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68091"
FT                   /db_xref="GOA:Q82QW3"
FT                   /db_xref="InterPro:IPR010667"
FT                   /db_xref="InterPro:IPR011747"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QW3"
FT                   /protein_id="BAC68091.1"
FT                   /translation="MAQFTVNAARLDPYKNFKFRVKWDNRYVAGISKVSALKRTTEVVE
FT                   HRDGGDHSSARKSPGRTKYEPITLERGVTHDPEFEAWANKVWNYANAQAAPDQRDREVS
FT                   LAGFRKDLVIEVYNEAGQKVLAYQVFRCWVSEYQALPDLDANANAVAIQQLKLENEGWL
FT                   REASVTEPGEPSF"
     atggcccagt tcacggtcaa tgccgcccgc ctggacccgt acaagaactt caagttccgg        60
     gtgaagtggg acaaccgcta tgtcgccggg atcagcaagg tcagcgcgct caagcgcacc       120
     accgaggtgg tcgagcaccg cgacggcggc gaccactcca gtgcccgcaa gtcaccgggc       180
     cggaccaagt acgagccgat caccctggag cgcggggtca cccacgaccc ggagttcgag       240
     gcgtgggcga acaaggtgtg gaactacgcc aacgcccagg cggcgccgga ccagcgggac       300
     cgcgaggtct ccctggccgg gttccgcaag gacctggtga tcgaggtcta caacgaggcg       360
     ggccagaagg tgctggccta ccaggtgttc cgttgctggg tgtcggagta ccaggcgctg       420
     ccagacctcg acgccaacgc caacgcggtc gccatccagc agctgaagct ggagaacgag       480
     ggctggctgc gcgaagcgag cgtcaccgag cccggtgagc ccagcttctg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page