(data stored in ACNUC7421 zone)

EMBL: BA000030.PE388

BA000030.PE388       Location/Qualifiers
FT   CDS_pept        456898..458088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_385"
FT                   /old_locus_tag="SAV_385"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_385"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68094"
FT                   /db_xref="InterPro:IPR025351"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QW0"
FT                   /protein_id="BAC68094.1"
FT                   /translation="MSNSLALAAVTATLRARLFSRLGGPQVTVAPPNKAPDAASGDHVN
FT                   LFLYRADLNPAFRNADPPGWQPGESPKPVLPLVLHYLLAAYSNDEGKAHELLGAAMLAL
FT                   HDAPVLSGDEIRAATATALPGSDLHLQPERVKITQETLSQDDIAKMWTAFGTPFRMSSA
FT                   YQVTAVLIDSALPGAAPMPVLRRGADGRGPLARPGTGSPALLGIRYAAAGQVGALPGEQ
FT                   VALLVENLPAVALTARLRHLRVTQSVNVPLATPATGASEVALTLPATGLPAGLWAVDLG
FT                   PAAGGSVRTNELALGVTPAVTALAAAAAGGTPVRTKVTVTAAQPVLPGQQAAVLVGARQ
FT                   LAVGLLTAAAKPVSVTAVLPSGKTRVRLRVDGVDSEIVDRAHGTFRTGPTVEVTIP"
     atgagcaact cccttgccct cgcggccgtg accgccaccc tgcgcgctcg gctcttctcc        60
     cggctcggcg gcccccaggt caccgtcgcc ccgcccaaca aggcgcccga cgcggcgagc       120
     ggcgaccatg tgaacctctt cctgtaccgg gccgatctca acccggcctt ccgcaacgcc       180
     gatccgcccg gctggcagcc cggcgagtca ccgaaacccg tgctgccgct ggtgctgcac       240
     tatctgctcg ccgcatacag caacgacgag ggcaaagcgc acgaactgct tggcgccgcg       300
     atgctggcgc tgcacgacgc cccggtcctg tcgggggacg agatccgggc ggcgacggcg       360
     acggccctgc ccggcagcga tctgcatcta cagcccgagc gcgtgaagat cactcaggag       420
     acgctgagcc aggacgacat cgccaagatg tggacggcgt tcgggacacc gttccggatg       480
     tcgtccgcgt accaggtgac cgccgtcctc atcgacagcg cattgcccgg tgccgcgccg       540
     atgcccgtgc tgcgccgagg ggccgacggc cgcggaccgc tcgcccggcc cggtaccggc       600
     tcgcccgcgc tgctggggat ccggtacgcc gccgccgggc aggtcggcgc cctgccgggc       660
     gagcaggtcg cgctactggt ggagaacctg ccggccgtcg ccctgaccgc gcggctgcgg       720
     catctgcgcg tgacacagag cgtgaacgtg cccctggcga cccccgccac cggggcctcc       780
     gaggtggcgc tcacgctgcc cgccacgggg ctccccgccg ggctctgggc ggtggacctc       840
     ggacccgcgg cgggcggttc cgtgcggacc aacgaactcg ctctgggcgt cacaccggcg       900
     gtcaccgcgc tcgcggccgc ggcggcgggc ggtacaccgg tgcggacgaa ggtgaccgtg       960
     acggccgcgc agccggtgct ccccgggcag caggccgcgg tcctggtcgg cgcccggcaa      1020
     ctggccgtgg gactgctcac cgcggccgcc aaaccggtct cggtcaccgc cgtcctgccg      1080
     tccggaaaga cccgggtgcg gctgcgggtg gacggcgtcg acagcgagat cgtcgaccgg      1140
     gcacacggca cgttccggac cgggccgaca gtggaggtga cgatcccgtg a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page