(data stored in ACNUC7421 zone)

EMBL: BA000030.PE389

BA000030.PE389       Location/Qualifiers
FT   CDS_pept        458085..459584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_386"
FT                   /old_locus_tag="SAV_386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_386"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68095"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QV9"
FT                   /protein_id="BAC68095.1"
FT                   /translation="MSLGVPADLRWEEANNRYLKASLTWLRARLEAVAHSDRASDAPDT
FT                   KDAPPQTGSARRRRRGRTPELPPAAVDLPDGGPGGSRRGRAPEPLTAVPDAGDLDALAT
FT                   TRQDAAAPSDLAPPALVRLAERFGLTDFERDVLLLVVAPAVDPGVGAAIAAAHGDPQAT
FT                   APTFALALRLFDDARWDVLSPLRPLRRWRLAEVVPAPAGPLLTAPLRPDDRIANLVRGL
FT                   NHLDERLTSVLEPVADPAAGVASPASVRRAEDAVVAAVLADTPDGRFPVVHLVGSDADS
FT                   AVLVAVRAFARLERELYRLRTGLLVRGGQGQQDPDTVALLWHRESLLMPVALLLDGTDA
FT                   DPDDPALVAAVRRLLSRSGGPVVLAARQVSPVDGRSTAVVDVDVPPPDEQRALWAAATG
FT                   LEPAGAPAELAGQFRLGLPALHRVATAHRPEGLSAEDGGDRLWGGLPGRRPASPGVAGA
FT                   AHRAPRSLGGPGAAGAADGGAAADGRSCAARRHRVWGLGLR"
     gtgagcctcg gcgtcccggc cgacctccgc tgggaggagg ccaacaaccg ttatctgaag        60
     gcctcgttga cctggctgcg ggctcggctg gaggcggtgg cccacagcga ccgggcctcc       120
     gacgccccgg acacgaagga cgcccctccc cagaccggca gcgcgcgccg gaggcggcgg       180
     gggcgaacgc ccgaactacc acccgcggcc gtggacctac cggacggcgg cccaggcggg       240
     tcacggcgag gacgagcccc ggagccgctg accgccgtac ccgacgcggg cgacctcgac       300
     gcactcgcca ccacacggca ggacgccgcc gccccctcgg acctcgcgcc gcccgcgctg       360
     gtgcggctcg cggagcggtt cgggctgacc gacttcgagc gcgacgtgct cctgctggtc       420
     gtggcgcccg cggtcgaccc cggtgtcggc gccgcgatcg ccgccgcaca cggcgacccg       480
     caggccaccg ctccgacgtt cgcactggcc ctacggctct tcgacgacgc ccgctgggac       540
     gtgctgtcgc cgctacggcc gctgcgccgc tggcggctcg ccgaggtcgt gcccgcaccc       600
     gcgggaccgc tgctcacggc gccgctgcgc cctgacgacc ggatcgccaa cctggtgcgc       660
     ggcctcaacc acctcgacga acggctcacc tcggtactcg aaccggtcgc cgacccggcc       720
     gccggcgtcg cctcgcccgc ctcggtccga cgcgccgagg acgcggtggt ggcggccgtg       780
     ctcgccgaca cgcccgacgg ccggttcccc gtcgtccacc tcgtcggctc cgacgccgac       840
     agtgccgtac tcgtggcggt acgggcgttc gcacggctcg aacgcgagct gtaccggctg       900
     cggacggggc tgctggtgcg gggcgggcaa ggccaacaag accctgacac ggtggccctg       960
     ctgtggcacc gggagagtct gctgatgccg gtcgcgctgc tcctggacgg caccgacgcc      1020
     gacccggacg acccggccct ggtcgcggcc gtacggcgcc tgctgtcccg cagcggcggg      1080
     cccgtcgtgc tggccgcgcg tcaggtgtcg ccagtggacg ggcggtccac ggcggtcgtc      1140
     gacgtcgatg tgccgccgcc cgacgagcag cgcgcgctgt gggcggccgc caccggcctg      1200
     gagcccgccg gggcgccggc cgagctggcg gggcagttcc gcctgggcct gcccgcactg      1260
     caccgggtgg ccaccgccca ccggcccgag ggcctctccg ccgaagacgg cggggaccgg      1320
     ttgtggggcg gcctgccggg acgccgcccg gcctcgcctg gagtcgctgg cgcagcgcat      1380
     cgtgccccgc gctcactggg cggacctggt gctgccggag cagcagacgg aggtgctgcg      1440
     gcggatggcc ggtcatgtgc ggcacggcgc caccgtgttt ggggactggg gcttcggtga      1500
//

If you have problems or comments...

PBIL Back to PBIL home page