(data stored in ACNUC7421 zone)

EMBL: BA000030.PE399

BA000030.PE399       Location/Qualifiers
FT   CDS_pept        469462..471561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_396"
FT                   /old_locus_tag="SAV_396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_396"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68105"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QU9"
FT                   /protein_id="BAC68105.1"
FT                   /translation="MSSPPPDRLYDLLPAVHRGRDEEQGFPLRALLRIVEEQVRVIEED
FT                   LDTWYANWFVETCEDWVVPYIGALVGTRPPPPGSSPGAVRALSPRQDVADAVANRRRKG
FT                   GAAALEAVALDSSGWPARAVELYRHLVRAQHARHVRLDRPATFAVRDPLACARLGGPFD
FT                   DAPHLVDVRRPNSTQTRGLHGIPSLALFVWRLRAFPVTRAPAFCIDQRYSRYLVNVLGI
FT                   DTRLFAPAPQGPAPARVSGPGDVPHPLGREEFEAAVTEYYGPGRSLEIWRDSPDNPVPA
FT                   EQIIVADLTDWRYRPRPGQVVVDPVLGRIAFPADEAPEDGVWVSWHYGFADAMGGGAYR
FT                   RPQTPVGERKLYAVGGEDDLGSITAALRQWRADKAADPSLHDALIEIRDSADYTEALRI
FT                   DLDEDDRLEIRAARGERPVVRLLNQKANRFDALTVRATAKKPPPGTVADCPPPATRRPQ
FT                   LVLDGLVVSGRSLDVVGQIGEVLVRHCTLVPGWELDHDCRPRWGEEPSVELRRTTARLR
FT                   VEHSIVGTIVVDQDETKGNPLTVEILDSIVDATSHDLPAVTAPEDRFAHAELTLRRCTV
FT                   LGDVRVHALPLGENSIVTGCLHTLRRDTGCLRYSYAPVSHPGPPRYRCATDPARPHFTS
FT                   TRYGHPGYCQLHTACDPLISTGAEDGAELGAFHDLYQPQSLSNLVGHLAEYVPLGVEAA
FT                   VITAT"
     atgagcagcc cgccccccga ccgcctctac gacctgctgc ccgcggtcca ccgcggccgc        60
     gacgaggaac agggcttccc gctgcgggcg ttgctgcgga tcgtcgagga gcaggtccgg       120
     gtgatcgagg aggacctgga cacctggtac gccaactggt tcgtggagac gtgcgaggac       180
     tgggtggtgc cgtacatcgg cgccctggtc ggcacccgcc ccccgccgcc gggcagttca       240
     cccggagcgg tccgcgcgct gtcgccgcgc caggacgtgg cggacgcggt ggcgaaccgg       300
     cgtcgcaagg gcggtgcggc ggcgctggag gcggtcgccc tggacagttc cggctggccc       360
     gcccgggccg tcgagctgta ccggcacctg gtgcgcgccc agcacgcacg gcatgtgcgg       420
     ctcgaccgcc ccgccacctt cgccgtgcgc gacccgctgg cctgcgcccg gctcggcggc       480
     cccttcgacg acgcgccgca cctggtcgac gtacggcggc cgaacagcac gcagacccgt       540
     gggctgcacg gcatcccgag tctggccctg ttcgtctggc ggctgcgggc cttcccggtg       600
     acccgggcgc cggcgttctg catcgaccag cgctacagcc gctatctcgt caacgtcctc       660
     ggtatcgaca cccggttgtt cgccccggca ccgcaaggcc cggcgcccgc acgggtgtcg       720
     ggccccggcg acgtaccgca tccgctgggg cgggaggagt tcgaggccgc cgtcaccgag       780
     tactacggcc caggcagaag cctggagatc tggcgggact cccccgacaa cccggtaccg       840
     gcggaacaga tcatcgtcgc cgacctcacc gactggcgct atcggccgcg gccggggcag       900
     gtcgtggtcg acccggtgct cggccggatc gccttcccgg cggacgaggc gccggaggac       960
     ggggtgtggg tgagctggca ctacggtttc gccgacgcga tgggcggtgg cgcgtaccga      1020
     cgcccgcaga ccccggtcgg cgaacgcaag ctgtacgcgg tgggcggcga ggacgacttg      1080
     ggctcgatca cggccgcgct gcggcagtgg cgggcggaca aggcagcgga tccgtccctt      1140
     catgacgcgc tgatcgagat ccgcgactcg gccgactaca cggaggccct gcggatcgac      1200
     ctggacgagg acgaccggct cgagatacgc gccgcacgtg gtgaacgccc ggtcgtccgc      1260
     ctgctcaacc agaaggccaa ccgcttcgac gcgctcaccg tacgggccac cgcgaagaag      1320
     ccgccgcccg gcacggtcgc cgactgcccg ccgccggcca cccgccgccc gcaactggtc      1380
     ctggacggtc tggtggtgag cggccgcagc cttgacgtgg tcggccagat cggcgaagtg      1440
     ctggtccgcc actgcacgtt ggtccccggc tgggagttgg accacgattg ccgcccccgc      1500
     tggggcgagg aaccgtccgt cgaactgcgc cgcaccacag cccgcctacg cgtggagcat      1560
     tcaatagtcg gcacgatcgt ggtggaccag gacgagacga agggcaaccc gctgaccgtc      1620
     gagatcctgg actcgatcgt cgacgccacg tcccacgacc tgcccgccgt gacagccccc      1680
     gaggaccgtt tcgcccacgc cgagttgacc ctgcgccgct gcacggtcct gggcgacgtg      1740
     cgcgtccacg ccctccccct cggcgagaac agcatcgtca cgggctgcct gcacaccctc      1800
     cgccgcgaca cgggctgtct gcgctactcg tacgccccgg tctcgcaccc tggcccgccc      1860
     cgctaccgct gcgccacgga ccccgcccgt ccgcacttca ccagcacccg ctacggccac      1920
     cccggctact gccaactcca caccgcctgc gacccgttga tctccacggg cgccgaggac      1980
     ggcgccgagc tgggcgcctt ccacgacctg taccagcccc aaagcctgag caacctcgtc      2040
     ggccatctcg ccgagtacgt gccgctcggc gtcgaggcag ccgtcatcac cgccacctag      2100
//

If you have problems or comments...

PBIL Back to PBIL home page